Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4213574..4214355 | Replicon | chromosome |
| Accession | NZ_CP113540 | ||
| Organism | Salmonella enterica strain CYX | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | B5R980 |
| Locus tag | OXV10_RS20700 | Protein ID | WP_000626100.1 |
| Coordinates | 4213574..4214065 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | OXV10_RS20705 | Protein ID | WP_001110452.1 |
| Coordinates | 4214062..4214355 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV10_RS20665 (4209034) | 4209034..4209381 | + | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
| OXV10_RS20670 (4209357) | 4209357..4211060 | + | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
| OXV10_RS20675 (4211097) | 4211097..4211672 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
| OXV10_RS20685 (4211943) | 4211943..4212017 | - | 75 | Protein_4043 | helix-turn-helix domain-containing protein | - |
| OXV10_RS20690 (4212397) | 4212397..4212474 | + | 78 | Protein_4044 | porin family protein | - |
| OXV10_RS20695 (4212574) | 4212574..4213326 | + | 753 | WP_000842433.1 | non-specific acid phosphatase | - |
| OXV10_RS20700 (4213574) | 4213574..4214065 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
| OXV10_RS20705 (4214062) | 4214062..4214355 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| OXV10_RS20710 (4214672) | 4214672..4214893 | + | 222 | WP_001576552.1 | hypothetical protein | - |
| OXV10_RS20715 (4215159) | 4215159..4216034 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
| OXV10_RS20720 (4216031) | 4216031..4216318 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
| OXV10_RS20725 (4216311) | 4216311..4216619 | - | 309 | WP_072095651.1 | ABC transporter ATP-binding protein | - |
| OXV10_RS20730 (4216618) | 4216618..4216866 | + | 249 | Protein_4052 | Ig-like domain-containing protein | - |
| OXV10_RS20735 (4216978) | 4216978..4217109 | + | 132 | Protein_4053 | hypothetical protein | - |
| OXV10_RS20740 (4217403) | 4217403..4218308 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T266003 WP_000626100.1 NZ_CP113540:c4214065-4213574 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656IQ80 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |