Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4106678..4107194 | Replicon | chromosome |
Accession | NZ_CP113540 | ||
Organism | Salmonella enterica strain CYX |
Toxin (Protein)
Gene name | relE | Uniprot ID | B5R9I9 |
Locus tag | OXV10_RS20125 | Protein ID | WP_000220582.1 |
Coordinates | 4106678..4106962 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | OXV10_RS20130 | Protein ID | WP_000212724.1 |
Coordinates | 4106952..4107194 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV10_RS20110 (4101889) | 4101889..4103541 | + | 1653 | WP_000155048.1 | alpha,alpha-phosphotrehalase | - |
OXV10_RS20115 (4103950) | 4103950..4106088 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OXV10_RS20120 (4106210) | 4106210..4106674 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OXV10_RS20125 (4106678) | 4106678..4106962 | - | 285 | WP_000220582.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OXV10_RS20130 (4106952) | 4106952..4107194 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OXV10_RS20135 (4107272) | 4107272..4109185 | - | 1914 | WP_001212142.1 | BglG family transcription antiterminator | - |
OXV10_RS20140 (4109202) | 4109202..4109942 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
OXV10_RS20145 (4109939) | 4109939..4111057 | - | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
OXV10_RS20150 (4111041) | 4111041..4112174 | - | 1134 | WP_000459957.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.66 Da Isoelectric Point: 9.6743
>T266002 WP_000220582.1 NZ_CP113540:c4106962-4106678 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656ILJ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |