Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4065553..4066103 | Replicon | chromosome |
Accession | NZ_CP113540 | ||
Organism | Salmonella enterica strain CYX |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | OXV10_RS19915 | Protein ID | WP_001199743.1 |
Coordinates | 4065553..4065861 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | M7RP97 |
Locus tag | OXV10_RS19920 | Protein ID | WP_001118105.1 |
Coordinates | 4065864..4066103 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV10_RS19895 (4062127) | 4062127..4062867 | - | 741 | WP_001676217.1 | SEF14/SEF18 fimbria chaperone SefB | - |
OXV10_RS19900 (4062989) | 4062989..4063519 | - | 531 | WP_000909461.1 | SEF14 fimbria major subunit SefA | - |
OXV10_RS19905 (4063842) | 4063842..4064975 | + | 1134 | Protein_3892 | IS3 family transposase | - |
OXV10_RS19910 (4065007) | 4065007..4065147 | - | 141 | Protein_3893 | Arm DNA-binding domain-containing protein | - |
OXV10_RS19915 (4065553) | 4065553..4065861 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
OXV10_RS19920 (4065864) | 4065864..4066103 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
OXV10_RS19925 (4066212) | 4066212..4066460 | - | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
OXV10_RS19930 (4066651) | 4066651..4067082 | - | 432 | Protein_3897 | helix-turn-helix domain-containing protein | - |
OXV10_RS19940 (4067839) | 4067839..4068858 | + | 1020 | WP_000152558.1 | NAD(P)-dependent alcohol dehydrogenase | - |
OXV10_RS19945 (4068886) | 4068886..4069416 | - | 531 | WP_000896758.1 | gluconokinase | - |
OXV10_RS19950 (4069633) | 4069633..4070664 | + | 1032 | WP_000453347.1 | L-idonate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 4063934..4067037 | 3103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T266001 WP_001199743.1 NZ_CP113540:c4065861-4065553 [Salmonella enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H9SZK8 |