Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4021293..4021869 | Replicon | chromosome |
| Accession | NZ_CP113540 | ||
| Organism | Salmonella enterica strain CYX | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | OXV10_RS19700 | Protein ID | WP_001131963.1 |
| Coordinates | 4021582..4021869 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | B5R9R5 |
| Locus tag | OXV10_RS19695 | Protein ID | WP_000063142.1 |
| Coordinates | 4021293..4021595 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV10_RS19680 (4017803) | 4017803..4019953 | + | 2151 | WP_000379928.1 | pyruvate/proton symporter BtsT | - |
| OXV10_RS19685 (4020048) | 4020048..4020251 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| OXV10_RS19690 (4020262) | 4020262..4021218 | + | 957 | WP_000187843.1 | GTPase | - |
| OXV10_RS19695 (4021293) | 4021293..4021595 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
| OXV10_RS19700 (4021582) | 4021582..4021869 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| OXV10_RS19705 (4022286) | 4022286..4023542 | + | 1257 | Protein_3852 | NERD domain-containing protein/DEAD/DEAH box helicase | - |
| OXV10_RS19710 (4023536) | 4023536..4023715 | + | 180 | Protein_3853 | DNA methyltransferase | - |
| OXV10_RS19715 (4023705) | 4023705..4025009 | + | 1305 | WP_000863534.1 | type I restriction-modification protein specificity subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T266000 WP_001131963.1 NZ_CP113540:c4021869-4021582 [Salmonella enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 | |
| AlphaFold DB | A0A4D6PB01 |