Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3445763..3446383 | Replicon | chromosome |
Accession | NZ_CP113540 | ||
Organism | Salmonella enterica strain CYX |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | OXV10_RS17050 | Protein ID | WP_001280991.1 |
Coordinates | 3446165..3446383 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | OXV10_RS17045 | Protein ID | WP_000344807.1 |
Coordinates | 3445763..3446137 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV10_RS17035 (3440902) | 3440902..3442095 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OXV10_RS17040 (3442118) | 3442118..3445267 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
OXV10_RS17045 (3445763) | 3445763..3446137 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
OXV10_RS17050 (3446165) | 3446165..3446383 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
OXV10_RS17055 (3446562) | 3446562..3447113 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
OXV10_RS17060 (3447231) | 3447231..3447701 | + | 471 | WP_000136183.1 | YlaC family protein | - |
OXV10_RS17065 (3447757) | 3447757..3447897 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
OXV10_RS17070 (3447903) | 3447903..3448163 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
OXV10_RS17075 (3448388) | 3448388..3449938 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
OXV10_RS17085 (3450169) | 3450169..3450558 | + | 390 | WP_000961287.1 | MGMT family protein | - |
OXV10_RS17090 (3450591) | 3450591..3451160 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T265997 WP_001280991.1 NZ_CP113540:3446165-3446383 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT265997 WP_000344807.1 NZ_CP113540:3445763-3446137 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|