Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4225587..4226368 | Replicon | chromosome |
Accession | NZ_CP113539 | ||
Organism | Salmonella enterica strain FFL |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A5I1HVL4 |
Locus tag | OXV09_RS20520 | Protein ID | WP_023255089.1 |
Coordinates | 4225587..4226078 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | OXV09_RS20525 | Protein ID | WP_001271379.1 |
Coordinates | 4226075..4226368 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV09_RS20495 (4222468) | 4222468..4223298 | - | 831 | WP_079948288.1 | fimbria/pilus periplasmic chaperone | - |
OXV09_RS20500 (4223500) | 4223500..4223712 | - | 213 | WP_001293880.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
OXV09_RS20505 (4224337) | 4224337..4224480 | + | 144 | Protein_4012 | transposase | - |
OXV09_RS20510 (4224497) | 4224497..4224843 | + | 347 | Protein_4013 | Rpn family recombination-promoting nuclease/putative transposase | - |
OXV09_RS20515 (4225124) | 4225124..4225372 | - | 249 | Protein_4014 | IS481 family transposase | - |
OXV09_RS20520 (4225587) | 4225587..4226078 | - | 492 | WP_023255089.1 | GNAT family N-acetyltransferase | Toxin |
OXV09_RS20525 (4226075) | 4226075..4226368 | - | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
OXV09_RS20530 (4226686) | 4226686..4226908 | + | 223 | Protein_4017 | hypothetical protein | - |
OXV09_RS20535 (4227174) | 4227174..4228049 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
OXV09_RS20540 (4228046) | 4228046..4228333 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
OXV09_RS20545 (4228356) | 4228356..4228570 | + | 215 | Protein_4020 | hypothetical protein | - |
OXV09_RS20550 (4228578) | 4228578..4228721 | + | 144 | Protein_4021 | hypothetical protein | - |
OXV09_RS20555 (4228833) | 4228833..4228922 | + | 90 | Protein_4022 | hypothetical protein | - |
OXV09_RS20560 (4229211) | 4229211..4230116 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4214980..4228922 | 13942 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17633.45 Da Isoelectric Point: 7.7297
>T265983 WP_023255089.1 NZ_CP113539:c4226078-4225587 [Salmonella enterica]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1HVL4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |