Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4111006..4111522 | Replicon | chromosome |
Accession | NZ_CP113539 | ||
Organism | Salmonella enterica strain FFL |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5I6CHB9 |
Locus tag | OXV09_RS19890 | Protein ID | WP_000220581.1 |
Coordinates | 4111006..4111290 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | OXV09_RS19895 | Protein ID | WP_000212724.1 |
Coordinates | 4111280..4111522 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV09_RS19875 (4106218) | 4106218..4107870 | + | 1653 | WP_023257400.1 | alpha,alpha-phosphotrehalase | - |
OXV09_RS19880 (4108279) | 4108279..4110417 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OXV09_RS19885 (4110538) | 4110538..4111002 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OXV09_RS19890 (4111006) | 4111006..4111290 | - | 285 | WP_000220581.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OXV09_RS19895 (4111280) | 4111280..4111522 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OXV09_RS19900 (4111600) | 4111600..4113513 | - | 1914 | WP_001212148.1 | BglG family transcription antiterminator | - |
OXV09_RS19905 (4113530) | 4113530..4114270 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
OXV09_RS19910 (4114267) | 4114267..4115385 | - | 1119 | WP_023256352.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
OXV09_RS19915 (4115369) | 4115369..4116502 | - | 1134 | WP_023257225.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10868.70 Da Isoelectric Point: 10.0482
>T265982 WP_000220581.1 NZ_CP113539:c4111290-4111006 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I6CHB9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |