Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4025857..4026433 | Replicon | chromosome |
Accession | NZ_CP113539 | ||
Organism | Salmonella enterica strain FFL |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | OXV09_RS19500 | Protein ID | WP_001131963.1 |
Coordinates | 4026146..4026433 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A5J0SGD3 |
Locus tag | OXV09_RS19495 | Protein ID | WP_023254955.1 |
Coordinates | 4025857..4026159 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV09_RS19480 (4022367) | 4022367..4024517 | + | 2151 | WP_000379927.1 | pyruvate/proton symporter BtsT | - |
OXV09_RS19485 (4024612) | 4024612..4024815 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
OXV09_RS19490 (4024826) | 4024826..4025782 | + | 957 | WP_000187838.1 | GTPase | - |
OXV09_RS19495 (4025857) | 4025857..4026159 | - | 303 | WP_023254955.1 | BrnA antitoxin family protein | Antitoxin |
OXV09_RS19500 (4026146) | 4026146..4026433 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
OXV09_RS19505 (4026702) | 4026702..4027616 | - | 915 | WP_000290515.1 | restriction endonuclease | - |
OXV09_RS19510 (4027814) | 4027814..4031323 | + | 3510 | WP_023256869.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T265981 WP_001131963.1 NZ_CP113539:c4026433-4026146 [Salmonella enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|