Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3410421..3411041 | Replicon | chromosome |
Accession | NZ_CP113539 | ||
Organism | Salmonella enterica strain FFL |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | OXV09_RS16655 | Protein ID | WP_001280991.1 |
Coordinates | 3410823..3411041 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | OXV09_RS16650 | Protein ID | WP_000344807.1 |
Coordinates | 3410421..3410795 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV09_RS16640 (3405560) | 3405560..3406753 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OXV09_RS16645 (3406776) | 3406776..3409925 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
OXV09_RS16650 (3410421) | 3410421..3410795 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
OXV09_RS16655 (3410823) | 3410823..3411041 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
OXV09_RS16660 (3411220) | 3411220..3411771 | + | 552 | WP_023243161.1 | maltose O-acetyltransferase | - |
OXV09_RS16665 (3411889) | 3411889..3412359 | + | 471 | WP_000136183.1 | YlaC family protein | - |
OXV09_RS16670 (3412415) | 3412415..3412555 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
OXV09_RS16675 (3412561) | 3412561..3412821 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
OXV09_RS16680 (3413046) | 3413046..3414596 | + | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
OXV09_RS16690 (3414827) | 3414827..3415216 | + | 390 | WP_000961285.1 | MGMT family protein | - |
OXV09_RS16695 (3415249) | 3415249..3415818 | - | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T265978 WP_001280991.1 NZ_CP113539:3410823-3411041 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT265978 WP_000344807.1 NZ_CP113539:3410421-3410795 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|