Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 219592..220352 | Replicon | chromosome |
| Accession | NZ_CP113539 | ||
| Organism | Salmonella enterica strain FFL | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A5J1SP54 |
| Locus tag | OXV09_RS01030 | Protein ID | WP_023256507.1 |
| Coordinates | 219867..220352 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | M7RHS4 |
| Locus tag | OXV09_RS01025 | Protein ID | WP_000965886.1 |
| Coordinates | 219592..219879 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV09_RS01005 (214997) | 214997..215908 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
| OXV09_RS01010 (215918) | 215918..217987 | + | 2070 | WP_023255847.1 | glycine--tRNA ligase subunit beta | - |
| OXV09_RS01015 (218377) | 218377..218775 | + | 399 | Protein_201 | IS3 family transposase | - |
| OXV09_RS01020 (218947) | 218947..219414 | + | 468 | WP_023256506.1 | GNAT family N-acetyltransferase | - |
| OXV09_RS01025 (219592) | 219592..219879 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
| OXV09_RS01030 (219867) | 219867..220352 | + | 486 | WP_023256507.1 | GNAT family N-acetyltransferase | Toxin |
| OXV09_RS01035 (220723) | 220723..221262 | - | 540 | WP_000047147.1 | copper-binding periplasmic metallochaperone CueP | - |
| OXV09_RS01040 (221436) | 221436..221648 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| OXV09_RS01045 (221936) | 221936..222226 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
| OXV09_RS01050 (222665) | 222665..223375 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
| OXV09_RS01055 (223425) | 223425..224399 | - | 975 | WP_000804674.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| OXV09_RS01060 (224618) | 224618..225280 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17749.42 Da Isoelectric Point: 9.7701
>T265969 WP_023256507.1 NZ_CP113539:219867-220352 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVYKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVELSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQQTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVYKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVELSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQQTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5J1SP54 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK8 | |
| AlphaFold DB | A0A3V2JDX2 |