Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4333575..4334356 | Replicon | chromosome |
Accession | NZ_CP113538 | ||
Organism | Salmonella enterica strain XSK |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | OXV06_RS20975 | Protein ID | WP_000626099.1 |
Coordinates | 4333575..4334066 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | OXV06_RS20980 | Protein ID | WP_001110452.1 |
Coordinates | 4334063..4334356 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV06_RS20940 (4329570) | 4329570..4330145 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
OXV06_RS20950 (4330416) | 4330416..4330493 | - | 78 | Protein_4093 | helix-turn-helix domain-containing protein | - |
OXV06_RS20955 (4330584) | 4330584..4330916 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
OXV06_RS20960 (4330988) | 4330988..4331365 | + | 378 | WP_000916345.1 | EthD family reductase | - |
OXV06_RS20965 (4332398) | 4332398..4332472 | + | 75 | Protein_4096 | porin family protein | - |
OXV06_RS20970 (4332575) | 4332575..4333327 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
OXV06_RS20975 (4333575) | 4333575..4334066 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
OXV06_RS20980 (4334063) | 4334063..4334356 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
OXV06_RS20985 (4334673) | 4334673..4334894 | + | 222 | WP_001576552.1 | hypothetical protein | - |
OXV06_RS20990 (4335159) | 4335159..4336034 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
OXV06_RS20995 (4336031) | 4336031..4336318 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
OXV06_RS21000 (4336341) | 4336341..4336556 | + | 216 | WP_001595136.1 | hypothetical protein | - |
OXV06_RS21005 (4336564) | 4336564..4336833 | + | 270 | WP_010989096.1 | hypothetical protein | - |
OXV06_RS21010 (4337127) | 4337127..4338032 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T265966 WP_000626099.1 NZ_CP113538:c4334066-4333575 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |