Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4130814..4131330 | Replicon | chromosome |
Accession | NZ_CP113538 | ||
Organism | Salmonella enterica strain XSK |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | OXV06_RS19915 | Protein ID | WP_000220578.1 |
Coordinates | 4130814..4131098 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | OXV06_RS19920 | Protein ID | WP_000212724.1 |
Coordinates | 4131088..4131330 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV06_RS19900 (4126026) | 4126026..4127678 | + | 1653 | WP_000155057.1 | alpha,alpha-phosphotrehalase | - |
OXV06_RS19905 (4128087) | 4128087..4130225 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OXV06_RS19910 (4130346) | 4130346..4130810 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OXV06_RS19915 (4130814) | 4130814..4131098 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OXV06_RS19920 (4131088) | 4131088..4131330 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OXV06_RS19925 (4131408) | 4131408..4133321 | - | 1914 | WP_001212137.1 | BglG family transcription antiterminator | - |
OXV06_RS19930 (4133338) | 4133338..4134078 | - | 741 | WP_000779263.1 | KDGP aldolase family protein | - |
OXV06_RS19935 (4134075) | 4134075..4135193 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
OXV06_RS19940 (4135177) | 4135177..4136310 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T265965 WP_000220578.1 NZ_CP113538:c4131098-4130814 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |