Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3433849..3434469 | Replicon | chromosome |
| Accession | NZ_CP113538 | ||
| Organism | Salmonella enterica strain XSK | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | OXV06_RS16745 | Protein ID | WP_001280991.1 |
| Coordinates | 3434251..3434469 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | OXV06_RS16740 | Protein ID | WP_000344807.1 |
| Coordinates | 3433849..3434223 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV06_RS16730 (3428988) | 3428988..3430181 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OXV06_RS16735 (3430204) | 3430204..3433353 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| OXV06_RS16740 (3433849) | 3433849..3434223 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| OXV06_RS16745 (3434251) | 3434251..3434469 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| OXV06_RS16750 (3434648) | 3434648..3435199 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| OXV06_RS16755 (3435316) | 3435316..3435786 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| OXV06_RS16760 (3435842) | 3435842..3435982 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| OXV06_RS16765 (3435988) | 3435988..3436248 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| OXV06_RS16770 (3436473) | 3436473..3438023 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
| OXV06_RS16780 (3438254) | 3438254..3438643 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| OXV06_RS16785 (3438676) | 3438676..3439245 | - | 570 | WP_268650663.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T265961 WP_001280991.1 NZ_CP113538:3434251-3434469 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT265961 WP_000344807.1 NZ_CP113538:3433849-3434223 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|