Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3345284..3345904 | Replicon | chromosome |
| Accession | NZ_CP113537 | ||
| Organism | Salmonella enterica strain YZY | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | OXV04_RS16130 | Protein ID | WP_001280991.1 |
| Coordinates | 3345686..3345904 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | OXV04_RS16125 | Protein ID | WP_000344807.1 |
| Coordinates | 3345284..3345658 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV04_RS16115 (3340423) | 3340423..3341616 | + | 1194 | WP_126524221.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OXV04_RS16120 (3341639) | 3341639..3344788 | + | 3150 | WP_126524222.1 | efflux RND transporter permease AcrB | - |
| OXV04_RS16125 (3345284) | 3345284..3345658 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| OXV04_RS16130 (3345686) | 3345686..3345904 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| OXV04_RS16135 (3346083) | 3346083..3346634 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| OXV04_RS16140 (3346752) | 3346752..3347222 | + | 471 | WP_126524223.1 | YlaC family protein | - |
| OXV04_RS16145 (3347278) | 3347278..3347418 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| OXV04_RS16150 (3347420) | 3347420..3347683 | - | 264 | WP_000801416.1 | type B 50S ribosomal protein L31 | - |
| OXV04_RS16155 (3347908) | 3347908..3349458 | + | 1551 | WP_126524224.1 | EAL domain-containing protein | - |
| OXV04_RS16165 (3349689) | 3349689..3350078 | + | 390 | WP_126524225.1 | MGMT family protein | - |
| OXV04_RS16170 (3350111) | 3350111..3350680 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T265944 WP_001280991.1 NZ_CP113537:3345686-3345904 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT265944 WP_000344807.1 NZ_CP113537:3345284-3345658 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|