Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 323847..324433 Replicon chromosome
Accession NZ_CP113537
Organism Salmonella enterica strain YZY

Toxin (Protein)


Gene name doc Uniprot ID A0A0R9MYB2
Locus tag OXV04_RS01490 Protein ID WP_000174966.1
Coordinates 324065..324433 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag OXV04_RS01485 Protein ID WP_001535398.1
Coordinates 323847..324068 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OXV04_RS01460 (318865) 318865..319974 + 1110 WP_126523776.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
OXV04_RS01465 (320036) 320036..320962 + 927 WP_126523777.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OXV04_RS01470 (320959) 320959..322236 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
OXV04_RS01475 (322233) 322233..323000 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OXV04_RS01480 (323002) 323002..323715 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OXV04_RS01485 (323847) 323847..324068 + 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OXV04_RS01490 (324065) 324065..324433 + 369 WP_000174966.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OXV04_RS01495 (324692) 324692..326008 + 1317 WP_000624749.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OXV04_RS01500 (326113) 326113..327000 + 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OXV04_RS01505 (326997) 326997..327842 + 846 WP_000572203.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OXV04_RS01510 (327845) 327845..328915 + 1071 WP_001646570.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 320959..329652 8693
- inside Prophage - - 313623..329652 16029


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13629.91 Da        Isoelectric Point: 6.4657

>T265936 WP_000174966.1 NZ_CP113537:324065-324433 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT265936 WP_001535398.1 NZ_CP113537:323847-324068 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9MYB2

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References