Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 213378..214138 | Replicon | chromosome |
Accession | NZ_CP113537 | ||
Organism | Salmonella enterica strain YZY |
Toxin (Protein)
Gene name | tacT | Uniprot ID | Q57IH1 |
Locus tag | OXV04_RS01005 | Protein ID | WP_000533909.1 |
Coordinates | 213653..214138 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | Q8Z2B2 |
Locus tag | OXV04_RS01000 | Protein ID | WP_000965889.1 |
Coordinates | 213378..213665 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV04_RS00980 (208724) | 208724..210052 | - | 1329 | WP_000200570.1 | MFS transporter | - |
OXV04_RS00985 (210240) | 210240..211400 | - | 1161 | WP_000107288.1 | mandelate racemase/muconate lactonizing enzyme family protein | - |
OXV04_RS00990 (211506) | 211506..212405 | + | 900 | WP_000462482.1 | LysR family transcriptional regulator | - |
OXV04_RS00995 (212542) | 212542..213195 | - | 654 | WP_126523757.1 | LysE family translocator | - |
OXV04_RS01000 (213378) | 213378..213665 | + | 288 | WP_000965889.1 | DUF1778 domain-containing protein | Antitoxin |
OXV04_RS01005 (213653) | 213653..214138 | + | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
OXV04_RS01010 (214509) | 214509..215048 | - | 540 | WP_126523758.1 | copper-binding periplasmic metallochaperone CueP | - |
OXV04_RS01015 (215221) | 215221..215433 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
OXV04_RS01020 (215721) | 215721..216011 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
OXV04_RS01025 (216450) | 216450..217160 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
OXV04_RS01030 (217210) | 217210..218184 | - | 975 | WP_000804684.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
OXV04_RS01035 (218403) | 218403..219065 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T265935 WP_000533909.1 NZ_CP113537:213653-214138 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7F36 | |
PDB | 7AK8 | |
PDB | 5FVJ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A752RW74 |