Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4338073..4338854 | Replicon | chromosome |
Accession | NZ_CP113536 | ||
Organism | Salmonella enterica strain ZCX |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | OXV07_RS21180 | Protein ID | WP_000626099.1 |
Coordinates | 4338073..4338564 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | OXV07_RS21185 | Protein ID | WP_001110452.1 |
Coordinates | 4338561..4338854 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV07_RS21145 (4334068) | 4334068..4334643 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
OXV07_RS21155 (4334914) | 4334914..4334991 | - | 78 | Protein_4135 | helix-turn-helix domain-containing protein | - |
OXV07_RS21160 (4335082) | 4335082..4335414 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
OXV07_RS21165 (4335486) | 4335486..4335863 | + | 378 | WP_000916345.1 | EthD family reductase | - |
OXV07_RS21170 (4336896) | 4336896..4336970 | + | 75 | Protein_4138 | porin family protein | - |
OXV07_RS21175 (4337073) | 4337073..4337825 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
OXV07_RS21180 (4338073) | 4338073..4338564 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
OXV07_RS21185 (4338561) | 4338561..4338854 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
OXV07_RS21190 (4339171) | 4339171..4339392 | + | 222 | WP_054175531.1 | hypothetical protein | - |
OXV07_RS21195 (4339657) | 4339657..4340532 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
OXV07_RS21200 (4340529) | 4340529..4340816 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
OXV07_RS21205 (4340839) | 4340839..4341054 | + | 216 | WP_001595136.1 | hypothetical protein | - |
OXV07_RS21210 (4341062) | 4341062..4341331 | + | 270 | WP_010989096.1 | hypothetical protein | - |
OXV07_RS21215 (4341625) | 4341625..4342530 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T265932 WP_000626099.1 NZ_CP113536:c4338564-4338073 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |