Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3515133..3515753 | Replicon | chromosome |
Accession | NZ_CP113536 | ||
Organism | Salmonella enterica strain ZCX |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | OXV07_RS17355 | Protein ID | WP_001280991.1 |
Coordinates | 3515535..3515753 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | OXV07_RS17350 | Protein ID | WP_000344807.1 |
Coordinates | 3515133..3515507 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV07_RS17340 (3510272) | 3510272..3511465 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OXV07_RS17345 (3511488) | 3511488..3514637 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
OXV07_RS17350 (3515133) | 3515133..3515507 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
OXV07_RS17355 (3515535) | 3515535..3515753 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
OXV07_RS17360 (3515932) | 3515932..3516483 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
OXV07_RS17365 (3516600) | 3516600..3517070 | + | 471 | WP_000136181.1 | YlaC family protein | - |
OXV07_RS17370 (3517126) | 3517126..3517266 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
OXV07_RS17375 (3517272) | 3517272..3517532 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
OXV07_RS17380 (3517757) | 3517757..3519307 | + | 1551 | WP_241594876.1 | EAL domain-containing protein | - |
OXV07_RS17390 (3519538) | 3519538..3519927 | + | 390 | WP_000961285.1 | MGMT family protein | - |
OXV07_RS17395 (3519960) | 3519960..3520529 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T265927 WP_001280991.1 NZ_CP113536:3515535-3515753 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT265927 WP_000344807.1 NZ_CP113536:3515133-3515507 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|