Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2350606..2351128 | Replicon | chromosome |
Accession | NZ_CP113536 | ||
Organism | Salmonella enterica strain ZCX |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | OXV07_RS11550 | Protein ID | WP_000221343.1 |
Coordinates | 2350606..2350890 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | OXV07_RS11555 | Protein ID | WP_000885424.1 |
Coordinates | 2350880..2351128 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV07_RS11530 (2346681) | 2346681..2348189 | - | 1509 | WP_023139072.1 | FAD-dependent oxidoreductase | - |
OXV07_RS11535 (2348234) | 2348234..2348722 | + | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
OXV07_RS11540 (2348915) | 2348915..2349994 | + | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
OXV07_RS11545 (2350046) | 2350046..2350435 | - | 390 | WP_000194089.1 | RidA family protein | - |
OXV07_RS11550 (2350606) | 2350606..2350890 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OXV07_RS11555 (2350880) | 2350880..2351128 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OXV07_RS11560 (2351280) | 2351280..2351495 | + | 216 | WP_000206207.1 | hypothetical protein | - |
OXV07_RS11565 (2351485) | 2351485..2351817 | + | 333 | WP_000253154.1 | DUF1493 family protein | - |
OXV07_RS11570 (2351960) | 2351960..2352868 | + | 909 | WP_010989018.1 | hypothetical protein | - |
OXV07_RS11575 (2352924) | 2352924..2353638 | - | 715 | Protein_2267 | helix-turn-helix domain-containing protein | - |
OXV07_RS11580 (2354446) | 2354446..2355912 | - | 1467 | WP_000987828.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T265922 WP_000221343.1 NZ_CP113536:c2350890-2350606 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |