Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 206528..207288 | Replicon | chromosome |
| Accession | NZ_CP113536 | ||
| Organism | Salmonella enterica strain ZCX | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | Q57IH1 |
| Locus tag | OXV07_RS00970 | Protein ID | WP_000533909.1 |
| Coordinates | 206803..207288 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | M7RHS4 |
| Locus tag | OXV07_RS00965 | Protein ID | WP_000965886.1 |
| Coordinates | 206528..206815 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV07_RS00940 (201823) | 201823..202125 | + | 303 | WP_000605590.1 | YsaB family lipoprotein | - |
| OXV07_RS00945 (202264) | 202264..203175 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
| OXV07_RS00950 (203185) | 203185..205254 | + | 2070 | WP_001291736.1 | glycine--tRNA ligase subunit beta | - |
| OXV07_RS00955 (205436) | 205436..205711 | + | 276 | Protein_189 | IS3 family transposase | - |
| OXV07_RS00960 (205883) | 205883..206350 | + | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
| OXV07_RS00965 (206528) | 206528..206815 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
| OXV07_RS00970 (206803) | 206803..207288 | + | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
| OXV07_RS00975 (207660) | 207660..208199 | - | 540 | WP_000047149.1 | copper-binding periplasmic metallochaperone CueP | - |
| OXV07_RS00980 (208373) | 208373..208585 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| OXV07_RS00985 (208874) | 208874..209164 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
| OXV07_RS00990 (209603) | 209603..210313 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
| OXV07_RS00995 (210363) | 210363..211337 | - | 975 | WP_000804674.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| OXV07_RS01000 (211556) | 211556..212218 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T265916 WP_000533909.1 NZ_CP113536:206803-207288 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7F36 | |
| PDB | 7AK8 | |
| PDB | 5FVJ |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK8 | |
| AlphaFold DB | A0A3V2JDX2 |