Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4414296..4415077 | Replicon | chromosome |
Accession | NZ_CP113535 | ||
Organism | Salmonella enterica strain ZLQ |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | OXV11_RS21730 | Protein ID | WP_000626099.1 |
Coordinates | 4414296..4414787 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | OXV11_RS21735 | Protein ID | WP_001110452.1 |
Coordinates | 4414784..4415077 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV11_RS21695 (4410291) | 4410291..4410866 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
OXV11_RS21705 (4411137) | 4411137..4411214 | - | 78 | Protein_4247 | helix-turn-helix domain-containing protein | - |
OXV11_RS21710 (4411305) | 4411305..4411637 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
OXV11_RS21715 (4411709) | 4411709..4412086 | + | 378 | WP_000916345.1 | EthD family reductase | - |
OXV11_RS21720 (4413119) | 4413119..4413193 | + | 75 | Protein_4250 | porin family protein | - |
OXV11_RS21725 (4413296) | 4413296..4414048 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
OXV11_RS21730 (4414296) | 4414296..4414787 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
OXV11_RS21735 (4414784) | 4414784..4415077 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
OXV11_RS21740 (4415394) | 4415394..4415615 | + | 222 | WP_001576552.1 | hypothetical protein | - |
OXV11_RS21745 (4415880) | 4415880..4416755 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
OXV11_RS21750 (4416752) | 4416752..4417039 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
OXV11_RS21755 (4417062) | 4417062..4417277 | + | 216 | WP_001595136.1 | hypothetical protein | - |
OXV11_RS21760 (4417285) | 4417285..4417554 | + | 270 | WP_010989096.1 | hypothetical protein | - |
OXV11_RS21765 (4417848) | 4417848..4418753 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T265913 WP_000626099.1 NZ_CP113535:c4414787-4414296 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|