Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4284959..4285475 | Replicon | chromosome |
Accession | NZ_CP113535 | ||
Organism | Salmonella enterica strain ZLQ |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | OXV11_RS21055 | Protein ID | WP_000220578.1 |
Coordinates | 4284959..4285243 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | OXV11_RS21060 | Protein ID | WP_000212724.1 |
Coordinates | 4285233..4285475 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV11_RS21040 (4280171) | 4280171..4281823 | + | 1653 | WP_000155057.1 | alpha,alpha-phosphotrehalase | - |
OXV11_RS21045 (4282232) | 4282232..4284370 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OXV11_RS21050 (4284491) | 4284491..4284955 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OXV11_RS21055 (4284959) | 4284959..4285243 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OXV11_RS21060 (4285233) | 4285233..4285475 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OXV11_RS21065 (4285553) | 4285553..4287466 | - | 1914 | WP_001212137.1 | BglG family transcription antiterminator | - |
OXV11_RS21070 (4287483) | 4287483..4288223 | - | 741 | WP_000779263.1 | KDGP aldolase family protein | - |
OXV11_RS21075 (4288220) | 4288220..4289338 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
OXV11_RS21080 (4289322) | 4289322..4290455 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T265912 WP_000220578.1 NZ_CP113535:c4285243-4284959 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |