Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4190698..4191274 | Replicon | chromosome |
Accession | NZ_CP113535 | ||
Organism | Salmonella enterica strain ZLQ |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | OXV11_RS20660 | Protein ID | WP_001131963.1 |
Coordinates | 4190987..4191274 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | B5R9R5 |
Locus tag | OXV11_RS20655 | Protein ID | WP_000063142.1 |
Coordinates | 4190698..4191000 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV11_RS20640 (4187208) | 4187208..4189358 | + | 2151 | WP_000379927.1 | pyruvate/proton symporter BtsT | - |
OXV11_RS20645 (4189453) | 4189453..4189656 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
OXV11_RS20650 (4189667) | 4189667..4190623 | + | 957 | WP_000187839.1 | GTPase | - |
OXV11_RS20655 (4190698) | 4190698..4191000 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
OXV11_RS20660 (4190987) | 4190987..4191274 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
OXV11_RS20665 (4191543) | 4191543..4192457 | - | 915 | WP_000290512.1 | restriction endonuclease | - |
OXV11_RS20670 (4192655) | 4192655..4196164 | + | 3510 | WP_001043484.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T265911 WP_001131963.1 NZ_CP113535:c4191274-4190987 [Salmonella enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7VD7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7VD7 | |
AlphaFold DB | A0A4D6PB01 |