Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3532801..3533421 | Replicon | chromosome |
| Accession | NZ_CP113535 | ||
| Organism | Salmonella enterica strain ZLQ | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | OXV11_RS17480 | Protein ID | WP_001280991.1 |
| Coordinates | 3533203..3533421 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | OXV11_RS17475 | Protein ID | WP_000344807.1 |
| Coordinates | 3532801..3533175 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV11_RS17465 (3527940) | 3527940..3529133 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OXV11_RS17470 (3529156) | 3529156..3532305 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| OXV11_RS17475 (3532801) | 3532801..3533175 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| OXV11_RS17480 (3533203) | 3533203..3533421 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| OXV11_RS17485 (3533600) | 3533600..3534151 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| OXV11_RS17490 (3534268) | 3534268..3534738 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| OXV11_RS17495 (3534794) | 3534794..3534934 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| OXV11_RS17500 (3534940) | 3534940..3535200 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| OXV11_RS17505 (3535425) | 3535425..3536975 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
| OXV11_RS17515 (3537206) | 3537206..3537595 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| OXV11_RS17520 (3537628) | 3537628..3538197 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T265908 WP_001280991.1 NZ_CP113535:3533203-3533421 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT265908 WP_000344807.1 NZ_CP113535:3532801-3533175 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|