Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4032561..4033077 | Replicon | chromosome |
| Accession | NZ_CP113534 | ||
| Organism | Salmonella enterica strain ZYX | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A5I6CHB9 |
| Locus tag | OXV08_RS19490 | Protein ID | WP_000220581.1 |
| Coordinates | 4032561..4032845 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | OXV08_RS19495 | Protein ID | WP_000212724.1 |
| Coordinates | 4032835..4033077 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV08_RS19475 (4027677) | 4027677..4029329 | + | 1653 | WP_080197320.1 | alpha,alpha-phosphotrehalase | - |
| OXV08_RS19480 (4029738) | 4029738..4031876 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| OXV08_RS19485 (4032093) | 4032093..4032557 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| OXV08_RS19490 (4032561) | 4032561..4032845 | - | 285 | WP_000220581.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OXV08_RS19495 (4032835) | 4032835..4033077 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OXV08_RS19500 (4033155) | 4033155..4035068 | - | 1914 | WP_139782548.1 | BglG family transcription antiterminator | - |
| OXV08_RS19505 (4035085) | 4035085..4035825 | - | 741 | WP_000779247.1 | KDGP aldolase family protein | - |
| OXV08_RS19510 (4035822) | 4035822..4036940 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| OXV08_RS19515 (4036924) | 4036924..4038057 | - | 1134 | WP_079986648.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10868.70 Da Isoelectric Point: 10.0482
>T265894 WP_000220581.1 NZ_CP113534:c4032845-4032561 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I6CHB9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |