Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 3947375..3947951 | Replicon | chromosome |
| Accession | NZ_CP113534 | ||
| Organism | Salmonella enterica strain ZYX | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | OXV08_RS19085 | Protein ID | WP_001131963.1 |
| Coordinates | 3947664..3947951 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A6C6ZAR7 |
| Locus tag | OXV08_RS19080 | Protein ID | WP_000063143.1 |
| Coordinates | 3947375..3947677 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV08_RS19065 (3943885) | 3943885..3946035 | + | 2151 | WP_000379928.1 | pyruvate/proton symporter BtsT | - |
| OXV08_RS19070 (3946130) | 3946130..3946333 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| OXV08_RS19075 (3946344) | 3946344..3947300 | + | 957 | WP_000612222.1 | GTPase | - |
| OXV08_RS19080 (3947375) | 3947375..3947677 | - | 303 | WP_000063143.1 | BrnA antitoxin family protein | Antitoxin |
| OXV08_RS19085 (3947664) | 3947664..3947951 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| OXV08_RS19090 (3948220) | 3948220..3949134 | - | 915 | WP_000290515.1 | restriction endonuclease | - |
| OXV08_RS19095 (3949332) | 3949332..3952841 | + | 3510 | WP_080197506.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T265893 WP_001131963.1 NZ_CP113534:c3947951-3947664 [Salmonella enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|