Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3350579..3351199 | Replicon | chromosome |
Accession | NZ_CP113534 | ||
Organism | Salmonella enterica strain ZYX |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | OXV08_RS16260 | Protein ID | WP_001280991.1 |
Coordinates | 3350981..3351199 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | OXV08_RS16255 | Protein ID | WP_000344807.1 |
Coordinates | 3350579..3350953 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV08_RS16245 (3345718) | 3345718..3346911 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OXV08_RS16250 (3346934) | 3346934..3350083 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
OXV08_RS16255 (3350579) | 3350579..3350953 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
OXV08_RS16260 (3350981) | 3350981..3351199 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
OXV08_RS16265 (3351378) | 3351378..3351929 | + | 552 | WP_080197358.1 | maltose O-acetyltransferase | - |
OXV08_RS16270 (3352046) | 3352046..3352516 | + | 471 | WP_000136183.1 | YlaC family protein | - |
OXV08_RS16275 (3352572) | 3352572..3352712 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
OXV08_RS16280 (3352718) | 3352718..3352978 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
OXV08_RS16285 (3353203) | 3353203..3354753 | + | 1551 | WP_080197357.1 | EAL domain-containing protein | - |
OXV08_RS16295 (3354984) | 3354984..3355373 | + | 390 | WP_000961285.1 | MGMT family protein | - |
OXV08_RS16300 (3355406) | 3355406..3355975 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T265890 WP_001280991.1 NZ_CP113534:3350981-3351199 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT265890 WP_000344807.1 NZ_CP113534:3350579-3350953 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|