Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2297222..2297744 | Replicon | chromosome |
Accession | NZ_CP113534 | ||
Organism | Salmonella enterica strain ZYX |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | OXV08_RS11015 | Protein ID | WP_000221343.1 |
Coordinates | 2297460..2297744 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | OXV08_RS11010 | Protein ID | WP_000885424.1 |
Coordinates | 2297222..2297470 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV08_RS10985 (2293621) | 2293621..2293743 | - | 123 | WP_001176644.1 | LysR family transcriptional regulator | - |
OXV08_RS10990 (2294554) | 2294554..2295289 | + | 736 | Protein_2148 | helix-turn-helix domain-containing protein | - |
OXV08_RS10995 (2295345) | 2295345..2296253 | - | 909 | WP_079927926.1 | hypothetical protein | - |
OXV08_RS11000 (2296533) | 2296533..2296865 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
OXV08_RS11005 (2296855) | 2296855..2297070 | - | 216 | WP_000206207.1 | hypothetical protein | - |
OXV08_RS11010 (2297222) | 2297222..2297470 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OXV08_RS11015 (2297460) | 2297460..2297744 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OXV08_RS11020 (2297915) | 2297915..2298304 | + | 390 | WP_000194089.1 | RidA family protein | - |
OXV08_RS11025 (2298356) | 2298356..2299435 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
OXV08_RS11030 (2299628) | 2299628..2300116 | - | 489 | WP_001293637.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
OXV08_RS11035 (2300161) | 2300161..2301504 | + | 1344 | Protein_2157 | FAD-dependent oxidoreductase | - |
OXV08_RS11040 (2301494) | 2301494..2302735 | + | 1242 | WP_080196988.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2292034..2304361 | 12327 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T265889 WP_000221343.1 NZ_CP113534:2297460-2297744 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |