Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 840596..841221 | Replicon | chromosome |
| Accession | NZ_CP113534 | ||
| Organism | Salmonella enterica strain ZYX | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OXV08_RS04050 | Protein ID | WP_000911337.1 |
| Coordinates | 840823..841221 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | C0PXM4 |
| Locus tag | OXV08_RS04045 | Protein ID | WP_000557545.1 |
| Coordinates | 840596..840823 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV08_RS04015 (835609) | 835609..837126 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| OXV08_RS04020 (837202) | 837202..837747 | - | 546 | WP_268653125.1 | isopentenyl-diphosphate Delta-isomerase | - |
| OXV08_RS04025 (838012) | 838012..838770 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
| OXV08_RS04035 (839055) | 839055..839861 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
| OXV08_RS04040 (840136) | 840136..840387 | - | 252 | WP_001540858.1 | hypothetical protein | - |
| OXV08_RS04045 (840596) | 840596..840823 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| OXV08_RS04050 (840823) | 840823..841221 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| OXV08_RS04055 (842028) | 842028..842564 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
| OXV08_RS04060 (842611) | 842611..843243 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| OXV08_RS04065 (843962) | 843962..844543 | + | 582 | WP_001244652.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 840136..850367 | 10231 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T265883 WP_000911337.1 NZ_CP113534:840823-841221 [Salmonella enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|