Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-phd/RelE(toxin) |
Location | 82665..83290 | Replicon | plasmid unnamed |
Accession | NZ_CP113530 | ||
Organism | Mycobacterium sp. Aquia_216 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OK015_RS28865 | Protein ID | WP_268133267.1 |
Coordinates | 82665..82955 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | OK015_RS28870 | Protein ID | WP_268133269.1 |
Coordinates | 83093..83290 (+) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK015_RS28845 (OK015_28845) | 78188..79102 | + | 915 | WP_268133261.1 | alpha/beta fold hydrolase | - |
OK015_RS28850 (OK015_28850) | 79804..81153 | + | 1350 | WP_268133387.1 | pyridoxal-dependent decarboxylase | - |
OK015_RS28855 (OK015_28855) | 81216..81998 | + | 783 | WP_268133263.1 | PhzF family phenazine biosynthesis protein | - |
OK015_RS28860 (OK015_28860) | 82382..82663 | + | 282 | WP_268133265.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
OK015_RS28865 (OK015_28865) | 82665..82955 | + | 291 | WP_268133267.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OK015_RS28870 (OK015_28870) | 83093..83290 | + | 198 | WP_268133269.1 | hypothetical protein | Antitoxin |
OK015_RS28875 (OK015_28875) | 83389..83664 | + | 276 | WP_268133389.1 | Fic family protein | - |
OK015_RS28880 (OK015_28880) | 83795..84619 | + | 825 | Protein_79 | serine/threonine-protein kinase | - |
OK015_RS28885 (OK015_28885) | 87334..88080 | - | 747 | Protein_80 | PE family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..113269 | 113269 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10891.48 Da Isoelectric Point: 10.8110
>T265878 WP_268133267.1 NZ_CP113530:82665-82955 [Mycobacterium sp. Aquia_216]
VAKPGRGYVTGFTATAKRDLDRLPPRILAAVIEFAFGDLACEPRRVGKPLGRDLAGHHGGRRGPYRLLYRIDDETQTIWV
HRVDHRAYVYRPPANR
VAKPGRGYVTGFTATAKRDLDRLPPRILAAVIEFAFGDLACEPRRVGKPLGRDLAGHHGGRRGPYRLLYRIDDETQTIWV
HRVDHRAYVYRPPANR
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|