Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 5462790..5463447 | Replicon | chromosome |
Accession | NZ_CP113529 | ||
Organism | Mycobacterium sp. Aquia_216 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | OK015_RS25455 | Protein ID | WP_268127285.1 |
Coordinates | 5462790..5463263 (-) | Length | 158 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | - |
Locus tag | OK015_RS25460 | Protein ID | WP_268127286.1 |
Coordinates | 5463268..5463447 (-) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK015_RS25430 (OK015_25430) | 5458765..5459991 | + | 1227 | WP_268127278.1 | acetyl-CoA acetyltransferase | - |
OK015_RS25435 (OK015_25435) | 5459993..5461504 | + | 1512 | WP_268127280.1 | carotenoid oxygenase family protein | - |
OK015_RS25440 (OK015_25440) | 5461542..5462027 | + | 486 | WP_268127282.1 | VOC family protein | - |
OK015_RS25445 (OK015_25445) | 5462032..5462466 | - | 435 | WP_268127284.1 | hypothetical protein | - |
OK015_RS25450 (OK015_25450) | 5462563..5462733 | - | 171 | Protein_5042 | VOC family protein | - |
OK015_RS25455 (OK015_25455) | 5462790..5463263 | - | 474 | WP_268127285.1 | SRPBCC family protein | Toxin |
OK015_RS25460 (OK015_25460) | 5463268..5463447 | - | 180 | WP_268127286.1 | antitoxin | Antitoxin |
OK015_RS25465 (OK015_25465) | 5463542..5465944 | - | 2403 | WP_268127288.1 | cation-translocating P-type ATPase | - |
OK015_RS25470 (OK015_25470) | 5465941..5467533 | - | 1593 | WP_268127291.1 | serine hydrolase | - |
OK015_RS25475 (OK015_25475) | 5467657..5468190 | + | 534 | WP_268127293.1 | G/U mismatch-specific DNA glycosylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 158 a.a. Molecular weight: 17080.81 Da Isoelectric Point: 10.1618
>T265876 WP_268127285.1 NZ_CP113529:c5463263-5462790 [Mycobacterium sp. Aquia_216]
MAKLSGSIEVPLPPEQAWKHASDLSRFKDWLSIHRVWRSKLPDDLHKGTVIESVVEVKGMLNRIKWTIVHYKPPEAMTLN
GDGVGGVKVKLIAKVKPKDDGSVVSFDVHLGGPALFGPIGMIVAAALRSDINESLERFVTVFTAPDPGRNGHSGVGR
MAKLSGSIEVPLPPEQAWKHASDLSRFKDWLSIHRVWRSKLPDDLHKGTVIESVVEVKGMLNRIKWTIVHYKPPEAMTLN
GDGVGGVKVKLIAKVKPKDDGSVVSFDVHLGGPALFGPIGMIVAAALRSDINESLERFVTVFTAPDPGRNGHSGVGR
Download Length: 474 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|