265875

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 5432..6033 Replicon plasmid unnamed
Accession NZ_CP113523
Organism Pasteurella multocida strain PF13

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OR605_RS10685 Protein ID WP_078819687.1
Coordinates 5432..5746 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OR605_RS10690 Protein ID WP_265176302.1
Coordinates 5743..6033 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OR605_RS10625 (OR605_10625) 747..977 + 231 WP_223251317.1 hypothetical protein -
OR605_RS10630 (OR605_10630) 1061..1264 - 204 WP_268169371.1 hypothetical protein -
OR605_RS10635 (OR605_10635) 1461..1727 - 267 WP_268169372.1 KilA-N domain-containing protein -
OR605_RS10640 (OR605_10640) 2002..2345 - 344 Protein_5 Bro-N domain-containing protein -
OR605_RS10645 (OR605_10645) 2686..2811 + 126 WP_014391103.1 hypothetical protein -
OR605_RS10650 (OR605_10650) 2812..3345 - 534 WP_014391102.1 hypothetical protein -
OR605_RS10655 (OR605_10655) 3433..3696 - 264 WP_071522857.1 hypothetical protein -
OR605_RS10660 (OR605_10660) 3908..4102 + 195 WP_014391459.1 hypothetical protein -
OR605_RS10665 (OR605_10665) 4083..4253 - 171 WP_014391460.1 hypothetical protein -
OR605_RS10670 (OR605_10670) 4266..4496 - 231 WP_075271373.1 hypothetical protein -
OR605_RS10675 (OR605_10675) 4738..4947 - 210 WP_005756656.1 hypothetical protein -
OR605_RS10680 (OR605_10680) 4960..5127 + 168 WP_005756653.1 DUF1508 domain-containing protein -
OR605_RS10685 (OR605_10685) 5432..5746 + 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OR605_RS10690 (OR605_10690) 5743..6033 + 291 WP_265176302.1 putative addiction module antidote protein Antitoxin
OR605_RS10695 (OR605_10695) 6060..6980 - 921 WP_265164248.1 hypothetical protein -
OR605_RS10700 (OR605_10700) 7071..7727 - 657 WP_016570077.1 XRE family transcriptional regulator -
OR605_RS10705 (OR605_10705) 7858..8064 + 207 WP_071523618.1 helix-turn-helix transcriptional regulator -
OR605_RS10710 (OR605_10710) 8352..8576 + 225 WP_268169373.1 hypothetical protein -
OR605_RS10715 (OR605_10715) 8628..9311 + 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
OR605_RS10720 (OR605_10720) 9308..9523 + 216 WP_075271368.1 hypothetical protein -
OR605_RS10725 (OR605_10725) 9520..9789 + 270 Protein_22 helix-turn-helix domain-containing protein -
OR605_RS10730 (OR605_10730) 9929..10333 + 405 WP_267174722.1 hypothetical protein -
OR605_RS10735 (OR605_10735) 10333..11022 + 690 WP_225529667.1 replication protein P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - orfM 1..260620 260620


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Uncharacterized protein HI1420

(6-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T265875 WP_078819687.1 NZ_CP113523:5432-5746 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10632.26 Da        Isoelectric Point: 5.1585

>AT265875 WP_265176302.1 NZ_CP113523:5743-6033 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAEKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References