Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 5432..6033 | Replicon | plasmid unnamed |
| Accession | NZ_CP113523 | ||
| Organism | Pasteurella multocida strain PF13 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OR605_RS10685 | Protein ID | WP_078819687.1 |
| Coordinates | 5432..5746 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OR605_RS10690 | Protein ID | WP_265176302.1 |
| Coordinates | 5743..6033 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OR605_RS10625 (OR605_10625) | 747..977 | + | 231 | WP_223251317.1 | hypothetical protein | - |
| OR605_RS10630 (OR605_10630) | 1061..1264 | - | 204 | WP_268169371.1 | hypothetical protein | - |
| OR605_RS10635 (OR605_10635) | 1461..1727 | - | 267 | WP_268169372.1 | KilA-N domain-containing protein | - |
| OR605_RS10640 (OR605_10640) | 2002..2345 | - | 344 | Protein_5 | Bro-N domain-containing protein | - |
| OR605_RS10645 (OR605_10645) | 2686..2811 | + | 126 | WP_014391103.1 | hypothetical protein | - |
| OR605_RS10650 (OR605_10650) | 2812..3345 | - | 534 | WP_014391102.1 | hypothetical protein | - |
| OR605_RS10655 (OR605_10655) | 3433..3696 | - | 264 | WP_071522857.1 | hypothetical protein | - |
| OR605_RS10660 (OR605_10660) | 3908..4102 | + | 195 | WP_014391459.1 | hypothetical protein | - |
| OR605_RS10665 (OR605_10665) | 4083..4253 | - | 171 | WP_014391460.1 | hypothetical protein | - |
| OR605_RS10670 (OR605_10670) | 4266..4496 | - | 231 | WP_075271373.1 | hypothetical protein | - |
| OR605_RS10675 (OR605_10675) | 4738..4947 | - | 210 | WP_005756656.1 | hypothetical protein | - |
| OR605_RS10680 (OR605_10680) | 4960..5127 | + | 168 | WP_005756653.1 | DUF1508 domain-containing protein | - |
| OR605_RS10685 (OR605_10685) | 5432..5746 | + | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OR605_RS10690 (OR605_10690) | 5743..6033 | + | 291 | WP_265176302.1 | putative addiction module antidote protein | Antitoxin |
| OR605_RS10695 (OR605_10695) | 6060..6980 | - | 921 | WP_265164248.1 | hypothetical protein | - |
| OR605_RS10700 (OR605_10700) | 7071..7727 | - | 657 | WP_016570077.1 | XRE family transcriptional regulator | - |
| OR605_RS10705 (OR605_10705) | 7858..8064 | + | 207 | WP_071523618.1 | helix-turn-helix transcriptional regulator | - |
| OR605_RS10710 (OR605_10710) | 8352..8576 | + | 225 | WP_268169373.1 | hypothetical protein | - |
| OR605_RS10715 (OR605_10715) | 8628..9311 | + | 684 | WP_014390721.1 | phage antirepressor KilAC domain-containing protein | - |
| OR605_RS10720 (OR605_10720) | 9308..9523 | + | 216 | WP_075271368.1 | hypothetical protein | - |
| OR605_RS10725 (OR605_10725) | 9520..9789 | + | 270 | Protein_22 | helix-turn-helix domain-containing protein | - |
| OR605_RS10730 (OR605_10730) | 9929..10333 | + | 405 | WP_267174722.1 | hypothetical protein | - |
| OR605_RS10735 (OR605_10735) | 10333..11022 | + | 690 | WP_225529667.1 | replication protein P | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | orfM | 1..260620 | 260620 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T265875 WP_078819687.1 NZ_CP113523:5432-5746 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|