Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 808524..809125 Replicon chromosome
Accession NZ_CP113522
Organism Pasteurella multocida strain PF13

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OR605_RS04110 Protein ID WP_078819687.1
Coordinates 808524..808838 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OR605_RS04115 Protein ID WP_265176302.1
Coordinates 808835..809125 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OR605_RS04055 (OR605_04055) 803822..804019 + 198 WP_268169362.1 hypothetical protein -
OR605_RS04060 (OR605_04060) 804184..804819 - 636 WP_268169368.1 KilA-N domain-containing protein -
OR605_RS04065 (OR605_04065) 805069..805437 - 369 Protein_787 Bro-N domain-containing protein -
OR605_RS04070 (OR605_04070) 805778..805903 + 126 WP_014391103.1 hypothetical protein -
OR605_RS04075 (OR605_04075) 805904..806437 - 534 WP_014391102.1 hypothetical protein -
OR605_RS04080 (OR605_04080) 806525..806788 - 264 WP_071522857.1 hypothetical protein -
OR605_RS04085 (OR605_04085) 807000..807194 + 195 WP_014391459.1 hypothetical protein -
OR605_RS04090 (OR605_04090) 807175..807345 - 171 WP_014391460.1 hypothetical protein -
OR605_RS04095 (OR605_04095) 807358..807588 - 231 WP_075271373.1 hypothetical protein -
OR605_RS04100 (OR605_04100) 807830..808039 - 210 WP_005756656.1 hypothetical protein -
OR605_RS04105 (OR605_04105) 808052..808219 + 168 WP_005756653.1 DUF1508 domain-containing protein -
OR605_RS04110 (OR605_04110) 808524..808838 + 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OR605_RS04115 (OR605_04115) 808835..809125 + 291 WP_265176302.1 putative addiction module antidote protein Antitoxin
OR605_RS04120 (OR605_04120) 809152..810072 - 921 WP_265164248.1 hypothetical protein -
OR605_RS04125 (OR605_04125) 810163..810819 - 657 WP_016570077.1 XRE family transcriptional regulator -
OR605_RS04130 (OR605_04130) 810950..811156 + 207 WP_071523618.1 helix-turn-helix transcriptional regulator -
OR605_RS04135 (OR605_04135) 811205..811666 + 462 WP_267174535.1 hypothetical protein -
OR605_RS04140 (OR605_04140) 811718..812400 + 683 Protein_802 phage antirepressor KilAC domain-containing protein -
OR605_RS04145 (OR605_04145) 812397..812528 + 132 WP_268169363.1 hypothetical protein -
OR605_RS04150 (OR605_04150) 812613..813428 + 816 WP_266199956.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 795638..839162 43524


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Uncharacterized protein HI1420

(6-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T265874 WP_078819687.1 NZ_CP113522:808524-808838 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10632.26 Da        Isoelectric Point: 5.1585

>AT265874 WP_265176302.1 NZ_CP113522:808835-809125 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAEKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References