Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 808524..809125 | Replicon | chromosome |
| Accession | NZ_CP113522 | ||
| Organism | Pasteurella multocida strain PF13 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OR605_RS04110 | Protein ID | WP_078819687.1 |
| Coordinates | 808524..808838 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OR605_RS04115 | Protein ID | WP_265176302.1 |
| Coordinates | 808835..809125 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OR605_RS04055 (OR605_04055) | 803822..804019 | + | 198 | WP_268169362.1 | hypothetical protein | - |
| OR605_RS04060 (OR605_04060) | 804184..804819 | - | 636 | WP_268169368.1 | KilA-N domain-containing protein | - |
| OR605_RS04065 (OR605_04065) | 805069..805437 | - | 369 | Protein_787 | Bro-N domain-containing protein | - |
| OR605_RS04070 (OR605_04070) | 805778..805903 | + | 126 | WP_014391103.1 | hypothetical protein | - |
| OR605_RS04075 (OR605_04075) | 805904..806437 | - | 534 | WP_014391102.1 | hypothetical protein | - |
| OR605_RS04080 (OR605_04080) | 806525..806788 | - | 264 | WP_071522857.1 | hypothetical protein | - |
| OR605_RS04085 (OR605_04085) | 807000..807194 | + | 195 | WP_014391459.1 | hypothetical protein | - |
| OR605_RS04090 (OR605_04090) | 807175..807345 | - | 171 | WP_014391460.1 | hypothetical protein | - |
| OR605_RS04095 (OR605_04095) | 807358..807588 | - | 231 | WP_075271373.1 | hypothetical protein | - |
| OR605_RS04100 (OR605_04100) | 807830..808039 | - | 210 | WP_005756656.1 | hypothetical protein | - |
| OR605_RS04105 (OR605_04105) | 808052..808219 | + | 168 | WP_005756653.1 | DUF1508 domain-containing protein | - |
| OR605_RS04110 (OR605_04110) | 808524..808838 | + | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OR605_RS04115 (OR605_04115) | 808835..809125 | + | 291 | WP_265176302.1 | putative addiction module antidote protein | Antitoxin |
| OR605_RS04120 (OR605_04120) | 809152..810072 | - | 921 | WP_265164248.1 | hypothetical protein | - |
| OR605_RS04125 (OR605_04125) | 810163..810819 | - | 657 | WP_016570077.1 | XRE family transcriptional regulator | - |
| OR605_RS04130 (OR605_04130) | 810950..811156 | + | 207 | WP_071523618.1 | helix-turn-helix transcriptional regulator | - |
| OR605_RS04135 (OR605_04135) | 811205..811666 | + | 462 | WP_267174535.1 | hypothetical protein | - |
| OR605_RS04140 (OR605_04140) | 811718..812400 | + | 683 | Protein_802 | phage antirepressor KilAC domain-containing protein | - |
| OR605_RS04145 (OR605_04145) | 812397..812528 | + | 132 | WP_268169363.1 | hypothetical protein | - |
| OR605_RS04150 (OR605_04150) | 812613..813428 | + | 816 | WP_266199956.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 795638..839162 | 43524 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T265874 WP_078819687.1 NZ_CP113522:808524-808838 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|