Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 3771466..3772060 Replicon chromosome
Accession NZ_CP113517
Organism Methylomonas rapida strain MP1

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NM686_RS17750 Protein ID WP_255188596.1
Coordinates 3771466..3771648 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NM686_RS17755 Protein ID WP_255187826.1
Coordinates 3771668..3772060 (+) Length 131 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NM686_RS17715 (NM686_017715) 3767159..3767671 - 513 WP_255189181.1 hypothetical protein -
NM686_RS17720 (NM686_017720) 3768401..3769786 - 1386 WP_255187523.1 IS4 family transposase -
NM686_RS17725 (NM686_017725) 3769954..3770172 - 219 WP_255187821.1 hypothetical protein -
NM686_RS17730 (NM686_017730) 3770240..3770470 - 231 WP_255187822.1 hypothetical protein -
NM686_RS17735 (NM686_017735) 3770463..3770792 - 330 WP_255187823.1 hypothetical protein -
NM686_RS17740 (NM686_017740) 3770931..3771092 - 162 WP_255187824.1 hypothetical protein -
NM686_RS17745 (NM686_017745) 3771134..3771400 - 267 WP_255187825.1 hypothetical protein -
NM686_RS17750 (NM686_017750) 3771466..3771648 + 183 WP_255188596.1 type II toxin-antitoxin system HicA family toxin Toxin
NM686_RS17755 (NM686_017755) 3771668..3772060 + 393 WP_255187826.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NM686_RS17760 (NM686_017760) 3772085..3772381 - 297 WP_255187827.1 helix-turn-helix domain-containing protein -
NM686_RS17765 (NM686_017765) 3772385..3772627 - 243 WP_255189182.1 hypothetical protein -
NM686_RS17770 (NM686_017770) 3772602..3772808 - 207 WP_255187829.1 hypothetical protein -
NM686_RS17775 (NM686_017775) 3772805..3773353 - 549 WP_255187830.1 3'-5' exonuclease -
NM686_RS17780 (NM686_017780) 3773356..3773541 - 186 WP_255189183.1 hypothetical protein -
NM686_RS17785 (NM686_017785) 3773550..3774089 - 540 WP_255189184.1 glycosyl hydrolase 108 family protein -
NM686_RS17790 (NM686_017790) 3774086..3774664 - 579 WP_255187833.1 hypothetical protein -
NM686_RS17795 (NM686_017795) 3774869..3776254 + 1386 WP_255187523.1 IS4 family transposase -
NM686_RS17800 (NM686_017800) 3776469..3776888 - 420 WP_255189185.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3765019..3788084 23065
- flank IS/Tn - - 3768401..3769786 1385
- flank IS/Tn - - 3774869..3776254 1385


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-125)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6986.04 Da        Isoelectric Point: 10.7532

>T265869 WP_255188596.1 NZ_CP113517:3771466-3771648 [Methylomonas rapida]
MNSKQLIKQLEQDGWYLARVKGSHHQFKHPTKPGLVTVKHPDSDIPKPTLHSIYRQAGWR

Download         Length: 183 bp

Antitoxin


Download         Length: 131 a.a.        Molecular weight: 13847.74 Da        Isoelectric Point: 4.7155

>AT265869 WP_255187826.1 NZ_CP113517:3771668-3772060 [Methylomonas rapida]
MKFTVVLHTDDGHHYGVIVPDLPGCFSAGDGIDEALSSVIEAIDLHVETLLEDGGDIPARLPIDAHKDNPDFAGGIWAVV
DAPIEKYFGPAEKINITLPKLLLAKIDSYAKAHGATRSGFLADAARSAMR

Download         Length: 393 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References