Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3771466..3772060 | Replicon | chromosome |
| Accession | NZ_CP113517 | ||
| Organism | Methylomonas rapida strain MP1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NM686_RS17750 | Protein ID | WP_255188596.1 |
| Coordinates | 3771466..3771648 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NM686_RS17755 | Protein ID | WP_255187826.1 |
| Coordinates | 3771668..3772060 (+) | Length | 131 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NM686_RS17715 (NM686_017715) | 3767159..3767671 | - | 513 | WP_255189181.1 | hypothetical protein | - |
| NM686_RS17720 (NM686_017720) | 3768401..3769786 | - | 1386 | WP_255187523.1 | IS4 family transposase | - |
| NM686_RS17725 (NM686_017725) | 3769954..3770172 | - | 219 | WP_255187821.1 | hypothetical protein | - |
| NM686_RS17730 (NM686_017730) | 3770240..3770470 | - | 231 | WP_255187822.1 | hypothetical protein | - |
| NM686_RS17735 (NM686_017735) | 3770463..3770792 | - | 330 | WP_255187823.1 | hypothetical protein | - |
| NM686_RS17740 (NM686_017740) | 3770931..3771092 | - | 162 | WP_255187824.1 | hypothetical protein | - |
| NM686_RS17745 (NM686_017745) | 3771134..3771400 | - | 267 | WP_255187825.1 | hypothetical protein | - |
| NM686_RS17750 (NM686_017750) | 3771466..3771648 | + | 183 | WP_255188596.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NM686_RS17755 (NM686_017755) | 3771668..3772060 | + | 393 | WP_255187826.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NM686_RS17760 (NM686_017760) | 3772085..3772381 | - | 297 | WP_255187827.1 | helix-turn-helix domain-containing protein | - |
| NM686_RS17765 (NM686_017765) | 3772385..3772627 | - | 243 | WP_255189182.1 | hypothetical protein | - |
| NM686_RS17770 (NM686_017770) | 3772602..3772808 | - | 207 | WP_255187829.1 | hypothetical protein | - |
| NM686_RS17775 (NM686_017775) | 3772805..3773353 | - | 549 | WP_255187830.1 | 3'-5' exonuclease | - |
| NM686_RS17780 (NM686_017780) | 3773356..3773541 | - | 186 | WP_255189183.1 | hypothetical protein | - |
| NM686_RS17785 (NM686_017785) | 3773550..3774089 | - | 540 | WP_255189184.1 | glycosyl hydrolase 108 family protein | - |
| NM686_RS17790 (NM686_017790) | 3774086..3774664 | - | 579 | WP_255187833.1 | hypothetical protein | - |
| NM686_RS17795 (NM686_017795) | 3774869..3776254 | + | 1386 | WP_255187523.1 | IS4 family transposase | - |
| NM686_RS17800 (NM686_017800) | 3776469..3776888 | - | 420 | WP_255189185.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3765019..3788084 | 23065 | |
| - | flank | IS/Tn | - | - | 3768401..3769786 | 1385 | |
| - | flank | IS/Tn | - | - | 3774869..3776254 | 1385 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6986.04 Da Isoelectric Point: 10.7532
>T265869 WP_255188596.1 NZ_CP113517:3771466-3771648 [Methylomonas rapida]
MNSKQLIKQLEQDGWYLARVKGSHHQFKHPTKPGLVTVKHPDSDIPKPTLHSIYRQAGWR
MNSKQLIKQLEQDGWYLARVKGSHHQFKHPTKPGLVTVKHPDSDIPKPTLHSIYRQAGWR
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 13847.74 Da Isoelectric Point: 4.7155
>AT265869 WP_255187826.1 NZ_CP113517:3771668-3772060 [Methylomonas rapida]
MKFTVVLHTDDGHHYGVIVPDLPGCFSAGDGIDEALSSVIEAIDLHVETLLEDGGDIPARLPIDAHKDNPDFAGGIWAVV
DAPIEKYFGPAEKINITLPKLLLAKIDSYAKAHGATRSGFLADAARSAMR
MKFTVVLHTDDGHHYGVIVPDLPGCFSAGDGIDEALSSVIEAIDLHVETLLEDGGDIPARLPIDAHKDNPDFAGGIWAVV
DAPIEKYFGPAEKINITLPKLLLAKIDSYAKAHGATRSGFLADAARSAMR
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|