Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 2276856..2277520 | Replicon | chromosome |
| Accession | NZ_CP113517 | ||
| Organism | Methylomonas rapida strain MP1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NM686_RS10755 | Protein ID | WP_255187871.1 |
| Coordinates | 2277092..2277520 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NM686_RS10750 | Protein ID | WP_255187870.1 |
| Coordinates | 2276856..2277095 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NM686_RS10725 (NM686_010725) | 2271940..2272221 | + | 282 | WP_255187866.1 | Mor transcription activator family protein | - |
| NM686_RS10730 (NM686_010730) | 2272279..2272590 | - | 312 | WP_255187867.1 | helix-turn-helix domain-containing protein | - |
| NM686_RS10735 (NM686_010735) | 2272592..2272879 | - | 288 | WP_269022874.1 | transcriptional regulator | - |
| NM686_RS10740 (NM686_010740) | 2273049..2276060 | - | 3012 | WP_255187869.1 | Tn3 family transposase | - |
| NM686_RS10745 (NM686_010745) | 2276077..2276655 | - | 579 | WP_255188597.1 | recombinase family protein | - |
| NM686_RS10750 (NM686_010750) | 2276856..2277095 | + | 240 | WP_255187870.1 | hypothetical protein | Antitoxin |
| NM686_RS10755 (NM686_010755) | 2277092..2277520 | + | 429 | WP_255187871.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NM686_RS10760 (NM686_010760) | 2277819..2279729 | - | 1911 | Protein_2132 | Tn3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2232653..2284763 | 52110 | |
| - | inside | IScluster/Tn | - | - | 2276077..2279741 | 3664 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15451.79 Da Isoelectric Point: 5.1356
>T265865 WP_255187871.1 NZ_CP113517:2277092-2277520 [Methylomonas rapida]
MILLDTNVVSEPLKASCDKSVLSWIDEQVIETLYLSTISLAELRFGIAVLPEGKRRDTLFSSLEQQVLPLFAGRILLFDE
SASQAYATLRARARTAGQAIATADGYIAAIAVAHGFAVATRDTSPFEAVGLKVINPWTWMAH
MILLDTNVVSEPLKASCDKSVLSWIDEQVIETLYLSTISLAELRFGIAVLPEGKRRDTLFSSLEQQVLPLFAGRILLFDE
SASQAYATLRARARTAGQAIATADGYIAAIAVAHGFAVATRDTSPFEAVGLKVINPWTWMAH
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|