Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2247140..2247734 | Replicon | chromosome |
| Accession | NZ_CP113517 | ||
| Organism | Methylomonas rapida strain MP1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NM686_RS10505 | Protein ID | WP_255188596.1 |
| Coordinates | 2247140..2247322 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NM686_RS10510 | Protein ID | WP_255187826.1 |
| Coordinates | 2247342..2247734 (+) | Length | 131 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NM686_RS10470 (NM686_010470) | 2242826..2243044 | - | 219 | WP_255187821.1 | hypothetical protein | - |
| NM686_RS10475 (NM686_010475) | 2243112..2243342 | - | 231 | WP_255187822.1 | hypothetical protein | - |
| NM686_RS10480 (NM686_010480) | 2243335..2243664 | - | 330 | WP_255187823.1 | hypothetical protein | - |
| NM686_RS10485 (NM686_010485) | 2243960..2245294 | - | 1335 | WP_255188233.1 | IS1380 family transposase | - |
| NM686_RS10490 (NM686_010490) | 2245483..2246526 | - | 1044 | WP_255188588.1 | transposase | - |
| NM686_RS10495 (NM686_010495) | 2246605..2246766 | - | 162 | WP_255187824.1 | hypothetical protein | - |
| NM686_RS10500 (NM686_010500) | 2246808..2247074 | - | 267 | WP_255187825.1 | hypothetical protein | - |
| NM686_RS10505 (NM686_010505) | 2247140..2247322 | + | 183 | WP_255188596.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NM686_RS10510 (NM686_010510) | 2247342..2247734 | + | 393 | WP_255187826.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NM686_RS10515 (NM686_010515) | 2247759..2248055 | - | 297 | WP_255187827.1 | helix-turn-helix domain-containing protein | - |
| NM686_RS10520 (NM686_010520) | 2248059..2248301 | - | 243 | WP_255189182.1 | hypothetical protein | - |
| NM686_RS10525 (NM686_010525) | 2248276..2248482 | - | 207 | WP_255187829.1 | hypothetical protein | - |
| NM686_RS10530 (NM686_010530) | 2248479..2249027 | - | 549 | WP_255187830.1 | 3'-5' exonuclease | - |
| NM686_RS10535 (NM686_010535) | 2249030..2249215 | - | 186 | WP_255187831.1 | hypothetical protein | - |
| NM686_RS10540 (NM686_010540) | 2249224..2249763 | - | 540 | WP_255187832.1 | glycosyl hydrolase 108 family protein | - |
| NM686_RS10545 (NM686_010545) | 2249760..2250338 | - | 579 | WP_255187833.1 | hypothetical protein | - |
| NM686_RS10550 (NM686_010550) | 2250498..2250785 | - | 288 | WP_255187834.1 | hypothetical protein | - |
| NM686_RS10555 (NM686_010555) | 2250767..2251057 | - | 291 | WP_255187835.1 | hypothetical protein | - |
| NM686_RS10560 (NM686_010560) | 2251392..2251673 | - | 282 | WP_255187836.1 | hypothetical protein | - |
| NM686_RS10565 (NM686_010565) | 2251986..2252216 | + | 231 | WP_255187837.1 | hypothetical protein | - |
| NM686_RS10570 (NM686_010570) | 2252213..2252431 | + | 219 | WP_255187838.1 | DUF2283 domain-containing protein | - |
| NM686_RS10575 (NM686_010575) | 2252443..2252682 | + | 240 | WP_255187839.1 | putative addiction module antidote protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2232653..2284763 | 52110 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6986.04 Da Isoelectric Point: 10.7532
>T265863 WP_255188596.1 NZ_CP113517:2247140-2247322 [Methylomonas rapida]
MNSKQLIKQLEQDGWYLARVKGSHHQFKHPTKPGLVTVKHPDSDIPKPTLHSIYRQAGWR
MNSKQLIKQLEQDGWYLARVKGSHHQFKHPTKPGLVTVKHPDSDIPKPTLHSIYRQAGWR
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 13847.74 Da Isoelectric Point: 4.7155
>AT265863 WP_255187826.1 NZ_CP113517:2247342-2247734 [Methylomonas rapida]
MKFTVVLHTDDGHHYGVIVPDLPGCFSAGDGIDEALSSVIEAIDLHVETLLEDGGDIPARLPIDAHKDNPDFAGGIWAVV
DAPIEKYFGPAEKINITLPKLLLAKIDSYAKAHGATRSGFLADAARSAMR
MKFTVVLHTDDGHHYGVIVPDLPGCFSAGDGIDEALSSVIEAIDLHVETLLEDGGDIPARLPIDAHKDNPDFAGGIWAVV
DAPIEKYFGPAEKINITLPKLLLAKIDSYAKAHGATRSGFLADAARSAMR
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|