Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1854371..1855050 | Replicon | chromosome |
Accession | NZ_CP113517 | ||
Organism | Methylomonas rapida strain MP1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NM686_RS08800 | Protein ID | WP_255187507.1 |
Coordinates | 1854616..1855050 (+) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NM686_RS08795 | Protein ID | WP_255187506.1 |
Coordinates | 1854371..1854616 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NM686_RS08765 (NM686_008765) | 1849656..1850204 | + | 549 | WP_269022943.1 | dTDP-4-dehydrorhamnose 3,5-epimerase | - |
NM686_RS08770 (NM686_008770) | 1850204..1851022 | + | 819 | WP_255187501.1 | ABC transporter permease | - |
NM686_RS08775 (NM686_008775) | 1851151..1851357 | + | 207 | WP_255187502.1 | nucleotidyltransferase domain-containing protein | - |
NM686_RS08780 (NM686_008780) | 1851836..1852855 | + | 1020 | WP_255187503.1 | hypothetical protein | - |
NM686_RS08785 (NM686_008785) | 1852980..1853276 | + | 297 | WP_255187504.1 | nucleotidyltransferase domain-containing protein | - |
NM686_RS08790 (NM686_008790) | 1853277..1853837 | + | 561 | WP_255187505.1 | hypothetical protein | - |
NM686_RS08795 (NM686_008795) | 1854371..1854616 | + | 246 | WP_255187506.1 | hypothetical protein | Antitoxin |
NM686_RS08800 (NM686_008800) | 1854616..1855050 | + | 435 | WP_255187507.1 | VapC toxin family PIN domain ribonuclease | Toxin |
NM686_RS08805 (NM686_008805) | 1855450..1855677 | + | 228 | WP_255187508.1 | hypothetical protein | - |
NM686_RS08810 (NM686_008810) | 1855674..1856069 | + | 396 | WP_255187509.1 | type II toxin-antitoxin system VapC family toxin | - |
NM686_RS08815 (NM686_008815) | 1856075..1857394 | + | 1320 | WP_255187510.1 | ABC transporter ATP-binding protein | - |
NM686_RS08820 (NM686_008820) | 1857575..1858414 | + | 840 | WP_255187511.1 | FkbM family methyltransferase | - |
NM686_RS08825 (NM686_008825) | 1858418..1859233 | + | 816 | WP_255187512.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15952.34 Da Isoelectric Point: 6.4814
>T265862 WP_255187507.1 NZ_CP113517:1854616-1855050 [Methylomonas rapida]
MRALLDVNVLIALMDAGHVHHEMAMNWLEKNLSFGWASCPITQNGCIRIMSQPNYPGALPVTQVADRLAEAVASVEHEFW
PDSISLLDSNVFSWSKVLGHRQVTDIYLLTLAVQNGGRFVTLDRRIAFDSVKGASPTQLVHLQA
MRALLDVNVLIALMDAGHVHHEMAMNWLEKNLSFGWASCPITQNGCIRIMSQPNYPGALPVTQVADRLAEAVASVEHEFW
PDSISLLDSNVFSWSKVLGHRQVTDIYLLTLAVQNGGRFVTLDRRIAFDSVKGASPTQLVHLQA
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|