Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 568831..569467 | Replicon | chromosome |
Accession | NZ_CP113516 | ||
Organism | Bacillus paralicheniformis strain 285-3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | M5P3Q9 |
Locus tag | OU809_RS02835 | Protein ID | WP_003179128.1 |
Coordinates | 569117..569467 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | M5PDU2 |
Locus tag | OU809_RS02830 | Protein ID | WP_006638778.1 |
Coordinates | 568831..569112 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OU809_RS02810 (OU809_02810) | 563942..565426 | + | 1485 | WP_103750290.1 | PH domain-containing protein | - |
OU809_RS02815 (OU809_02815) | 565423..566022 | - | 600 | WP_023857867.1 | rhomboid family intramembrane serine protease | - |
OU809_RS02820 (OU809_02820) | 566366..567325 | + | 960 | WP_164468292.1 | outer membrane lipoprotein carrier protein LolA | - |
OU809_RS02825 (OU809_02825) | 567550..568719 | + | 1170 | WP_186442187.1 | alanine racemase | - |
OU809_RS02830 (OU809_02830) | 568831..569112 | + | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
OU809_RS02835 (OU809_02835) | 569117..569467 | + | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OU809_RS02840 (OU809_02840) | 569585..570412 | + | 828 | WP_023857863.1 | RsbT co-antagonist protein RsbRA | - |
OU809_RS02845 (OU809_02845) | 570416..570781 | + | 366 | WP_031305225.1 | STAS domain-containing protein | - |
OU809_RS02850 (OU809_02850) | 570784..571185 | + | 402 | WP_023857861.1 | anti-sigma regulatory factor | - |
OU809_RS02855 (OU809_02855) | 571196..572203 | + | 1008 | WP_020450261.1 | PP2C family protein-serine/threonine phosphatase | - |
OU809_RS02860 (OU809_02860) | 572262..572588 | + | 327 | WP_020450262.1 | anti-sigma factor antagonist | - |
OU809_RS02865 (OU809_02865) | 572588..573070 | + | 483 | WP_020450263.1 | anti-sigma B factor RsbW | - |
OU809_RS02870 (OU809_02870) | 573036..573827 | + | 792 | WP_023857858.1 | RNA polymerase sigma factor SigB | - |
OU809_RS02875 (OU809_02875) | 573824..574423 | + | 600 | WP_023857857.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T265860 WP_003179128.1 NZ_CP113516:569117-569467 [Bacillus paralicheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6I7FHI4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | M5PDU2 |