Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 3678908..3679825 | Replicon | chromosome |
Accession | NZ_CP113515 | ||
Organism | Bacillus sp. KICET-1 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | OVA33_RS18310 | Protein ID | WP_007407256.1 |
Coordinates | 3678908..3679654 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | OVA33_RS18315 | Protein ID | WP_003154807.1 |
Coordinates | 3679655..3679825 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OVA33_RS18290 (3674301) | 3674301..3675251 | - | 951 | WP_007610844.1 | ring-cleaving dioxygenase | - |
OVA33_RS18295 (3675573) | 3675573..3676889 | + | 1317 | WP_063636817.1 | amino acid permease | - |
OVA33_RS18300 (3677176) | 3677176..3677793 | + | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
OVA33_RS18305 (3677806) | 3677806..3678804 | + | 999 | WP_017417610.1 | inorganic phosphate transporter | - |
OVA33_RS18310 (3678908) | 3678908..3679654 | + | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
OVA33_RS18315 (3679655) | 3679655..3679825 | + | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
OVA33_RS18320 (3679922) | 3679922..3680047 | + | 126 | WP_003154809.1 | hypothetical protein | - |
OVA33_RS18325 (3680082) | 3680082..3680960 | - | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
OVA33_RS18330 (3680974) | 3680974..3681237 | - | 264 | WP_003154813.1 | phage holin | - |
OVA33_RS18335 (3681251) | 3681251..3681514 | - | 264 | WP_021493821.1 | hemolysin XhlA family protein | - |
OVA33_RS18340 (3681566) | 3681566..3682327 | - | 762 | WP_063636818.1 | hypothetical protein | - |
OVA33_RS18345 (3682384) | 3682384..3682581 | - | 198 | WP_007610833.1 | XkdX family protein | - |
OVA33_RS18350 (3682586) | 3682586..3682957 | - | 372 | WP_038457736.1 | XkdW family protein | - |
OVA33_RS18355 (3682970) | 3682970..3683332 | - | 363 | WP_014721043.1 | hypothetical protein | - |
OVA33_RS18360 (3683443) | 3683443..3683994 | - | 552 | Protein_3571 | terminase | - |
OVA33_RS18365 (3684107) | 3684107..3684619 | - | 513 | WP_017417605.1 | sigma-70 family RNA polymerase sigma factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T265859 WP_007407256.1 NZ_CP113515:3678908-3679654 [Bacillus sp. KICET-1]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|