Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 395254..395891 | Replicon | chromosome |
Accession | NZ_CP113515 | ||
Organism | Bacillus sp. KICET-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | OVA33_RS02060 | Protein ID | WP_003156187.1 |
Coordinates | 395254..395604 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | OVA33_RS02065 | Protein ID | WP_003156188.1 |
Coordinates | 395610..395891 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OVA33_RS02020 (390294) | 390294..390896 | - | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
OVA33_RS02025 (390896) | 390896..391684 | - | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
OVA33_RS02030 (391650) | 391650..392132 | - | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
OVA33_RS02035 (392129) | 392129..392458 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
OVA33_RS02040 (392522) | 392522..393529 | - | 1008 | WP_007410233.1 | PP2C family protein-serine/threonine phosphatase | - |
OVA33_RS02045 (393541) | 393541..393942 | - | 402 | WP_017419223.1 | anti-sigma regulatory factor | - |
OVA33_RS02050 (393945) | 393945..394310 | - | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
OVA33_RS02055 (394315) | 394315..395136 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
OVA33_RS02060 (395254) | 395254..395604 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OVA33_RS02065 (395610) | 395610..395891 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
OVA33_RS02070 (396011) | 396011..397180 | - | 1170 | WP_065180972.1 | alanine racemase | - |
OVA33_RS02075 (397297) | 397297..398304 | - | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
OVA33_RS02080 (398469) | 398469..398834 | - | 366 | WP_007609580.1 | holo-ACP synthase | - |
OVA33_RS02085 (398927) | 398927..399526 | + | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T265858 WP_003156187.1 NZ_CP113515:c395604-395254 [Bacillus sp. KICET-1]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|