Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 4792732..4793267 | Replicon | chromosome |
Accession | NZ_CP113504 | ||
Organism | Pectobacterium brasiliense strain 21PCA_AGRO2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C6DJA0 |
Locus tag | OWC53_RS21980 | Protein ID | WP_015842269.1 |
Coordinates | 4792980..4793267 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q6DB37 |
Locus tag | OWC53_RS21975 | Protein ID | WP_010281712.1 |
Coordinates | 4792732..4792983 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWC53_RS21945 (OWC53_21930) | 4788170..4788496 | + | 327 | WP_014913674.1 | helix-turn-helix domain-containing protein | - |
OWC53_RS21950 (OWC53_21935) | 4788481..4788795 | + | 315 | WP_039528006.1 | HipA N-terminal domain-containing protein | - |
OWC53_RS21955 (OWC53_21940) | 4788792..4789832 | + | 1041 | WP_268197954.1 | HipA domain-containing protein | - |
OWC53_RS21960 (OWC53_21945) | 4789892..4790515 | - | 624 | WP_039284934.1 | LysE family translocator | - |
OWC53_RS21965 (OWC53_21950) | 4790783..4791538 | + | 756 | WP_110163156.1 | thiol:disulfide interchange protein DsbG | - |
OWC53_RS21970 (OWC53_21955) | 4791572..4792477 | - | 906 | WP_268197955.1 | siderophore-interacting protein | - |
OWC53_RS21975 (OWC53_21960) | 4792732..4792983 | + | 252 | WP_010281712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OWC53_RS21980 (OWC53_21965) | 4792980..4793267 | + | 288 | WP_015842269.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OWC53_RS21985 (OWC53_21970) | 4793371..4794723 | - | 1353 | WP_205559960.1 | glutathione-disulfide reductase | - |
OWC53_RS21990 (OWC53_21975) | 4794852..4795694 | - | 843 | WP_039498363.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
OWC53_RS21995 (OWC53_21980) | 4795845..4796642 | + | 798 | WP_268197956.1 | DUF1266 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11074.15 Da Isoelectric Point: 10.3527
>T265857 WP_015842269.1 NZ_CP113504:4792980-4793267 [Pectobacterium brasiliense]
MSYSVKFREDALKEWLKLDKTIQQQFAKKLKKCCENPHIPSAKLRGMKDCYKIKLRASGFRLVYEVIDDVLIIAVVAVGK
RERSGVYHLASERMR
MSYSVKFREDALKEWLKLDKTIQQQFAKKLKKCCENPHIPSAKLRGMKDCYKIKLRASGFRLVYEVIDDVLIIAVVAVGK
RERSGVYHLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S0XQ75 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2EZP0 |