Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 3996361..3997001 | Replicon | chromosome |
| Accession | NZ_CP113504 | ||
| Organism | Pectobacterium brasiliense strain 21PCA_AGRO2 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A7V8Q162 |
| Locus tag | OWC53_RS18355 | Protein ID | WP_039278477.1 |
| Coordinates | 3996361..3996777 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A086EF97 |
| Locus tag | OWC53_RS18360 | Protein ID | WP_039278475.1 |
| Coordinates | 3996774..3997001 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OWC53_RS18335 (OWC53_18320) | 3991946..3992932 | - | 987 | WP_039465906.1 | quinone oxidoreductase | - |
| OWC53_RS18340 (OWC53_18325) | 3993060..3994466 | + | 1407 | WP_010279223.1 | replicative DNA helicase | - |
| OWC53_RS18345 (OWC53_18330) | 3994508..3995590 | + | 1083 | WP_075278336.1 | alanine racemase | - |
| OWC53_RS18350 (OWC53_18335) | 3995583..3996221 | + | 639 | WP_039517591.1 | hypothetical protein | - |
| OWC53_RS18355 (OWC53_18340) | 3996361..3996777 | - | 417 | WP_039278477.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OWC53_RS18360 (OWC53_18345) | 3996774..3997001 | - | 228 | WP_039278475.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OWC53_RS18365 (OWC53_18350) | 3997794..3998273 | + | 480 | WP_010295086.1 | Lrp/AsnC family transcriptional regulator | - |
| OWC53_RS18370 (OWC53_18355) | 3998524..3999138 | + | 615 | WP_010279239.1 | YitT family protein | - |
| OWC53_RS18375 (OWC53_18360) | 3999202..4000395 | + | 1194 | WP_268197755.1 | amino acid aminotransferase | - |
| OWC53_RS18380 (OWC53_18365) | 4000479..4000976 | + | 498 | WP_052902928.1 | M48 family metallopeptidase | - |
| OWC53_RS18385 (OWC53_18370) | 4001358..4001594 | + | 237 | Protein_3589 | type VI secretion system tube protein TssD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15274.80 Da Isoelectric Point: 8.2931
>T265854 WP_039278477.1 NZ_CP113504:c3996777-3996361 [Pectobacterium brasiliense]
VSRLFMLDTNICSFIMREHPAEVIEKLQQCTLRRDRIVVSAITYAEMRFGAVGKKASPRHMQLVDAFCRRLDAVLPWDSA
AVDATTKIKIELAAAGTPIGPNDTAIAGHAISAKAILVTNNLREFERVPGLTLEDWVK
VSRLFMLDTNICSFIMREHPAEVIEKLQQCTLRRDRIVVSAITYAEMRFGAVGKKASPRHMQLVDAFCRRLDAVLPWDSA
AVDATTKIKIELAAAGTPIGPNDTAIAGHAISAKAILVTNNLREFERVPGLTLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V8Q162 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A086EF97 |