Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 1807743..1808377 Replicon chromosome
Accession NZ_CP113504
Organism Pectobacterium brasiliense strain 21PCA_AGRO2

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag OWC53_RS08355 Protein ID WP_161528673.1
Coordinates 1807973..1808377 (+) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID C6C2Z8
Locus tag OWC53_RS08350 Protein ID WP_012765080.1
Coordinates 1807743..1807973 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OWC53_RS08310 (OWC53_08300) 1802782..1803669 + 888 WP_268198609.1 50S ribosome-binding GTPase -
OWC53_RS08315 (OWC53_08305) 1803854..1804012 + 159 WP_154715508.1 hypothetical protein -
OWC53_RS08320 (OWC53_08310) 1804159..1804992 + 834 WP_268198610.1 hypothetical protein -
OWC53_RS08325 (OWC53_08315) 1805049..1805399 + 351 WP_268198611.1 hypothetical protein -
OWC53_RS08330 (OWC53_08320) 1805527..1806000 + 474 WP_233980543.1 DNA repair protein RadC -
OWC53_RS08335 (OWC53_08325) 1806040..1806435 + 396 WP_268198612.1 type IV toxin-antitoxin system YeeU family antitoxin -
OWC53_RS08340 (OWC53_08330) 1806378..1806698 + 321 WP_249653328.1 TA system toxin CbtA family protein -
OWC53_RS08345 (OWC53_08335) 1806816..1807649 + 834 WP_268198613.1 DUF4942 domain-containing protein -
OWC53_RS08350 (OWC53_08340) 1807743..1807973 + 231 WP_012765080.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
OWC53_RS08355 (OWC53_08345) 1807973..1808377 + 405 WP_161528673.1 tRNA(fMet)-specific endonuclease VapC Toxin
OWC53_RS08360 (OWC53_08350) 1808713..1808897 - 185 Protein_1624 integrase -
OWC53_RS08365 (OWC53_08355) 1809141..1809266 + 126 WP_268198614.1 hypothetical protein -
OWC53_RS08370 (OWC53_08360) 1809347..1810498 + 1152 WP_268198615.1 type I restriction endonuclease -
OWC53_RS08375 (OWC53_08365) 1810646..1811662 - 1017 WP_268198616.1 CAR family subclass B3 metallo-beta-lactamase -
OWC53_RS08380 (OWC53_08370) 1811774..1812673 + 900 WP_039498644.1 LysR family transcriptional regulator -
OWC53_RS08385 (OWC53_08375) 1812728..1813084 - 357 WP_052234619.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - flhD / flhC / motA / motB / cheA / cheW / cheD / cheR / cheB 1800190..1829405 29215


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(7-54)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 15029.26 Da        Isoelectric Point: 8.0253

>T265853 WP_161528673.1 NZ_CP113504:1807973-1808377 [Pectobacterium brasiliense]
MLKYLLDTNICIYTIKNKPQEVRDAFYRHYGQFAISAITLMELIYGAEKSVNPEKNLAVIEGFSARLEVQTYGFDAAVHT
GQIRAELARQGTPIGPYDAMLAGHARSAGLILVTNNVREFERVPGLRVENWVGR

Download         Length: 405 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8694.75 Da        Isoelectric Point: 4.3063

>AT265853 WP_012765080.1 NZ_CP113504:1807743-1807973 [Pectobacterium brasiliense]
MEKTTVFKSNRSQAVRLPKAVALPDDVKQVDIVAIGRTRIITPAGESWDSWFEEDGVTPDFMITREQPDDQIREDF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7V8Q8E4

References