Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1259468..1260093 | Replicon | chromosome |
Accession | NZ_CP113504 | ||
Organism | Pectobacterium brasiliense strain 21PCA_AGRO2 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | C6DB72 |
Locus tag | OWC53_RS05800 | Protein ID | WP_005976087.1 |
Coordinates | 1259468..1259671 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | Q6D809 |
Locus tag | OWC53_RS05805 | Protein ID | WP_010282247.1 |
Coordinates | 1259725..1260093 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWC53_RS05770 (OWC53_05765) | 1254801..1255139 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
OWC53_RS05775 (OWC53_05770) | 1255179..1256465 | + | 1287 | WP_014914537.1 | ammonium transporter AmtB | - |
OWC53_RS05780 (OWC53_05775) | 1256606..1257469 | - | 864 | WP_014914538.1 | acyl-CoA thioesterase II | - |
OWC53_RS05785 (OWC53_05780) | 1257682..1258263 | + | 582 | WP_014914539.1 | YbaY family lipoprotein | - |
OWC53_RS05790 (OWC53_05785) | 1258283..1258603 | - | 321 | WP_010282239.1 | MGMT family protein | - |
OWC53_RS05800 (OWC53_05795) | 1259468..1259671 | - | 204 | WP_005976087.1 | HHA domain-containing protein | Toxin |
OWC53_RS05805 (OWC53_05800) | 1259725..1260093 | - | 369 | WP_010282247.1 | Hha toxicity modulator TomB | Antitoxin |
OWC53_RS05810 (OWC53_05805) | 1260693..1260836 | - | 144 | WP_005976091.1 | type B 50S ribosomal protein L36 | - |
OWC53_RS05815 (OWC53_05810) | 1260854..1261102 | - | 249 | WP_014914542.1 | type B 50S ribosomal protein L31 | - |
OWC53_RS05820 (OWC53_05815) | 1261335..1264463 | - | 3129 | WP_205546137.1 | efflux RND transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8145.52 Da Isoelectric Point: 8.9008
>T265851 WP_005976087.1 NZ_CP113504:c1259671-1259468 [Pectobacterium brasiliense]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14046.80 Da Isoelectric Point: 4.4787
>AT265851 WP_010282247.1 NZ_CP113504:c1260093-1259725 [Pectobacterium brasiliense]
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRRWQKSKAKLFGMFSGENICTPAKT
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRRWQKSKAKLFGMFSGENICTPAKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7Z3F0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086EI31 |