Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1057096..1057622 | Replicon | chromosome |
Accession | NZ_CP113504 | ||
Organism | Pectobacterium brasiliense strain 21PCA_AGRO2 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | OWC53_RS04880 | Protein ID | WP_268198382.1 |
Coordinates | 1057096..1057401 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | E0SK21 |
Locus tag | OWC53_RS04885 | Protein ID | WP_012773205.1 |
Coordinates | 1057404..1057622 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWC53_RS04870 (OWC53_04865) | 1053756..1056413 | - | 2658 | WP_080163925.1 | hypothetical protein | - |
OWC53_RS04875 (OWC53_04870) | 1056542..1056898 | - | 357 | WP_080163924.1 | hypothetical protein | - |
OWC53_RS04880 (OWC53_04875) | 1057096..1057401 | - | 306 | WP_268198382.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
OWC53_RS04885 (OWC53_04880) | 1057404..1057622 | - | 219 | WP_012773205.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
OWC53_RS04890 (OWC53_04885) | 1057681..1058424 | - | 744 | WP_080163920.1 | MobC family replication-relaxation protein | - |
OWC53_RS04895 (OWC53_04890) | 1058566..1058736 | + | 171 | WP_155121810.1 | hypothetical protein | - |
OWC53_RS04900 (OWC53_04895) | 1059328..1059669 | - | 342 | WP_039309297.1 | hypothetical protein | - |
OWC53_RS04905 (OWC53_04900) | 1059855..1060049 | + | 195 | WP_080163917.1 | YlcI/YnfO family protein | - |
OWC53_RS04910 (OWC53_04905) | 1060156..1061415 | - | 1260 | WP_268198383.1 | integrase arm-type DNA-binding domain-containing protein | - |
OWC53_RS04920 (OWC53_04915) | 1061965..1062096 | + | 132 | WP_258069300.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1053099..1061593 | 8494 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11702.64 Da Isoelectric Point: 4.8382
>T265849 WP_268198382.1 NZ_CP113504:c1057401-1057096 [Pectobacterium brasiliense]
MQFIVYLYKRASHYKMFVDVQSDIVDTPKRRMVIPLIESHHLSEKVNKTLFPLIRIDGEDYRLMTTELSSVPVEVIGEVI
TDLGDCADEIKDALNLMFWGI
MQFIVYLYKRASHYKMFVDVQSDIVDTPKRRMVIPLIESHHLSEKVNKTLFPLIRIDGEDYRLMTTELSSVPVEVIGEVI
TDLGDCADEIKDALNLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|