Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 828429..829089 | Replicon | chromosome |
Accession | NZ_CP113504 | ||
Organism | Pectobacterium brasiliense strain 21PCA_AGRO2 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | OWC53_RS03895 | Protein ID | WP_010301815.1 |
Coordinates | 828715..829089 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A1D7Z1Z6 |
Locus tag | OWC53_RS03890 | Protein ID | WP_005971623.1 |
Coordinates | 828429..828695 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWC53_RS03870 (OWC53_03865) | 824255..825259 | - | 1005 | WP_039555591.1 | substrate-binding domain-containing protein | - |
OWC53_RS03875 (OWC53_03870) | 825314..825922 | - | 609 | WP_039502189.1 | HD domain-containing protein | - |
OWC53_RS03880 (OWC53_03875) | 826354..827001 | + | 648 | WP_010279833.1 | hemolysin III family protein | - |
OWC53_RS03885 (OWC53_03880) | 827192..828193 | - | 1002 | WP_268198304.1 | tRNA-modifying protein YgfZ | - |
OWC53_RS03890 (OWC53_03885) | 828429..828695 | + | 267 | WP_005971623.1 | FAD assembly factor SdhE | Antitoxin |
OWC53_RS03895 (OWC53_03890) | 828715..829089 | + | 375 | WP_010301815.1 | protein YgfX | Toxin |
OWC53_RS03900 (OWC53_03895) | 829158..830093 | + | 936 | WP_010301818.1 | 23S rRNA (adenine(1618)-N(6))-methyltransferase RlmF | - |
OWC53_RS03905 (OWC53_03900) | 830159..830482 | - | 324 | WP_268198305.1 | hypothetical protein | - |
OWC53_RS03910 (OWC53_03905) | 830511..831029 | - | 519 | WP_014914178.1 | flavodoxin FldB | - |
OWC53_RS03915 (OWC53_03910) | 831373..831759 | - | 387 | WP_039282122.1 | thioesterase family protein | - |
OWC53_RS03920 (OWC53_03915) | 831964..833292 | - | 1329 | WP_010279860.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14654.33 Da Isoelectric Point: 10.5560
>T265847 WP_010301815.1 NZ_CP113504:828715-829089 [Pectobacterium brasiliense]
MQLLSLVVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLNWRQQEWQIVKRPWLLKN
GVLLSLQAVNGKDKQQLWLASDSMGDDEWRHLRQILLQQKHWAR
MQLLSLVVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLNWRQQEWQIVKRPWLLKN
GVLLSLQAVNGKDKQQLWLASDSMGDDEWRHLRQILLQQKHWAR
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|