Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 763497..764222 | Replicon | chromosome |
Accession | NZ_CP113504 | ||
Organism | Pectobacterium brasiliense strain 21PCA_AGRO2 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | OWC53_RS03580 | Protein ID | WP_268198283.1 |
Coordinates | 763902..764222 (+) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | OWC53_RS03575 | Protein ID | WP_268198282.1 |
Coordinates | 763497..763832 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWC53_RS03545 (OWC53_03540) | 759117..760148 | + | 1032 | WP_268198278.1 | hypothetical protein | - |
OWC53_RS03550 (OWC53_03545) | 760244..761131 | + | 888 | WP_268198279.1 | 50S ribosome-binding GTPase | - |
OWC53_RS03555 (OWC53_03550) | 761315..761473 | + | 159 | WP_155242703.1 | hypothetical protein | - |
OWC53_RS03560 (OWC53_03555) | 761620..762453 | + | 834 | WP_268198280.1 | hypothetical protein | - |
OWC53_RS03565 (OWC53_03560) | 762511..762861 | + | 351 | WP_113631700.1 | hypothetical protein | - |
OWC53_RS03570 (OWC53_03565) | 762984..763457 | + | 474 | WP_268198281.1 | DNA repair protein RadC | - |
OWC53_RS03575 (OWC53_03570) | 763497..763832 | + | 336 | WP_268198282.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OWC53_RS03580 (OWC53_03575) | 763902..764222 | + | 321 | WP_268198283.1 | TA system toxin CbtA family protein | Toxin |
OWC53_RS03585 (OWC53_03580) | 764340..765173 | + | 834 | WP_268198841.1 | DUF4942 domain-containing protein | - |
OWC53_RS03590 (OWC53_03585) | 765582..765740 | - | 159 | Protein_698 | NADP-dependent oxidoreductase | - |
OWC53_RS03595 (OWC53_03590) | 765716..766105 | - | 390 | WP_268198284.1 | hypothetical protein | - |
OWC53_RS03600 (OWC53_03595) | 766343..766978 | - | 636 | WP_268198285.1 | hypothetical protein | - |
OWC53_RS03605 (OWC53_03600) | 767311..767730 | - | 420 | Protein_701 | lysozyme | - |
OWC53_RS03610 (OWC53_03605) | 767723..767939 | - | 217 | Protein_702 | hypothetical protein | - |
OWC53_RS03615 (OWC53_03610) | 768437..768856 | + | 420 | WP_240559198.1 | hypothetical protein | - |
OWC53_RS03620 (OWC53_03615) | 768898..769050 | + | 153 | WP_230857215.1 | LuxR C-terminal-related transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11991.72 Da Isoelectric Point: 5.0492
>T265846 WP_268198283.1 NZ_CP113504:763902-764222 [Pectobacterium brasiliense]
MQTSPAIPPREDNPCPSPIAVWQQLLTYLLEKHYGLTLNDTPFCEENVIQAHIDAGVTLVNAVNFLVEKYELVRIDRNGF
NWQEQSPFLTAVDVLRARRATGLLKA
MQTSPAIPPREDNPCPSPIAVWQQLLTYLLEKHYGLTLNDTPFCEENVIQAHIDAGVTLVNAVNFLVEKYELVRIDRNGF
NWQEQSPFLTAVDVLRARRATGLLKA
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|