Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 515360..515887 Replicon chromosome
Accession NZ_CP113504
Organism Pectobacterium brasiliense strain 21PCA_AGRO2

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OWC53_RS02420 Protein ID WP_039517502.1
Coordinates 515612..515887 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OWC53_RS02415 Protein ID WP_268198159.1
Coordinates 515360..515608 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OWC53_RS02375 (OWC53_02370) 510772..511470 + 699 WP_226054604.1 DeoR family transcriptional regulator -
OWC53_RS02380 (OWC53_02375) 511568..512221 + 654 WP_268198151.1 hypothetical protein -
OWC53_RS02385 (OWC53_02380) 512257..512730 + 474 WP_268198152.1 hypothetical protein -
OWC53_RS02390 (OWC53_02385) 512747..512980 + 234 WP_039308199.1 membrane protein -
OWC53_RS02395 (OWC53_02390) 513065..513538 + 474 WP_268198153.1 DNA repair protein RadC -
OWC53_RS02400 (OWC53_02395) 513578..513913 + 336 WP_268198155.1 type IV toxin-antitoxin system YeeU family antitoxin -
OWC53_RS02405 (OWC53_02400) 513982..514302 + 321 WP_268198156.1 TA system toxin CbtA family protein -
OWC53_RS02410 (OWC53_02405) 514420..515199 + 780 WP_268198158.1 DUF4942 domain-containing protein -
OWC53_RS02415 (OWC53_02410) 515360..515608 + 249 WP_268198159.1 ribbon-helix-helix domain-containing protein Antitoxin
OWC53_RS02420 (OWC53_02415) 515612..515887 + 276 WP_039517502.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OWC53_RS02425 (OWC53_02420) 515935..516447 + 513 WP_268198161.1 AAA family ATPase -
OWC53_RS02430 (OWC53_02425) 516966..517778 + 813 Protein_470 integrase arm-type DNA-binding domain-containing protein -
OWC53_RS02435 (OWC53_02430) 518003..518308 + 306 WP_268198162.1 helix-turn-helix transcriptional regulator -
OWC53_RS02440 (OWC53_02435) 518313..519647 + 1335 WP_268198163.1 type II toxin-antitoxin system HipA family toxin -
OWC53_RS02445 (OWC53_02440) 519713..520006 - 294 WP_268198164.1 AAA family ATPase -
OWC53_RS02450 (OWC53_02445) 520174..520593 + 420 WP_268198165.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(9-43)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 11028.25 Da        Isoelectric Point: 5.5034

>T265843 WP_039517502.1 NZ_CP113504:515612-515887 [Pectobacterium brasiliense]
MEIRWTQKAQDDLERIYGFASQYSRHHADEVLDRLIIGTTGIADHPRIGVSQTRYEPREVRKILFDDYEVHYEIQHDTIY
IVDLWHTREDR

Download         Length: 276 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9049.47 Da        Isoelectric Point: 8.7560

>AT265843 WP_268198159.1 NZ_CP113504:515360-515608 [Pectobacterium brasiliense]
MGQPAKQTISAQIPAELAAAVESLAIELDRSKSWVIKEALTAMIEERERRHQRILKGLADVDVGRVVSHADVIDFANKLK
KS

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References