Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 513578..514302 Replicon chromosome
Accession NZ_CP113504
Organism Pectobacterium brasiliense strain 21PCA_AGRO2

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag OWC53_RS02405 Protein ID WP_268198156.1
Coordinates 513982..514302 (+) Length 107 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag OWC53_RS02400 Protein ID WP_268198155.1
Coordinates 513578..513913 (+) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OWC53_RS02365 (OWC53_02360) 508610..509404 + 795 WP_268198150.1 hypothetical protein -
OWC53_RS02370 (OWC53_02365) 509528..510402 + 875 Protein_458 GTPase family protein -
OWC53_RS02375 (OWC53_02370) 510772..511470 + 699 WP_226054604.1 DeoR family transcriptional regulator -
OWC53_RS02380 (OWC53_02375) 511568..512221 + 654 WP_268198151.1 hypothetical protein -
OWC53_RS02385 (OWC53_02380) 512257..512730 + 474 WP_268198152.1 hypothetical protein -
OWC53_RS02390 (OWC53_02385) 512747..512980 + 234 WP_039308199.1 membrane protein -
OWC53_RS02395 (OWC53_02390) 513065..513538 + 474 WP_268198153.1 DNA repair protein RadC -
OWC53_RS02400 (OWC53_02395) 513578..513913 + 336 WP_268198155.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OWC53_RS02405 (OWC53_02400) 513982..514302 + 321 WP_268198156.1 TA system toxin CbtA family protein Toxin
OWC53_RS02410 (OWC53_02405) 514420..515199 + 780 WP_268198158.1 DUF4942 domain-containing protein -
OWC53_RS02415 (OWC53_02410) 515360..515608 + 249 WP_268198159.1 ribbon-helix-helix domain-containing protein -
OWC53_RS02420 (OWC53_02415) 515612..515887 + 276 WP_039517502.1 type II toxin-antitoxin system RelE/ParE family toxin -
OWC53_RS02425 (OWC53_02420) 515935..516447 + 513 WP_268198161.1 AAA family ATPase -
OWC53_RS02430 (OWC53_02425) 516966..517778 + 813 Protein_470 integrase arm-type DNA-binding domain-containing protein -
OWC53_RS02435 (OWC53_02430) 518003..518308 + 306 WP_268198162.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-105)

Antitoxin

Antitoxin CbeA

(7-106)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12006.73 Da        Isoelectric Point: 4.7627

>T265842 WP_268198156.1 NZ_CP113504:513982-514302 [Pectobacterium brasiliense]
MQTSPAIPPREDNPCPSPIAVWQQLLTYLLEKHYGLTLNDTPFCEENVIQAHIDAGITLVNAVNFLVEKYELVRIDRDGF
NWQEQSPFLTAVDVLRARRATGLLKA

Download         Length: 321 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12479.30 Da        Isoelectric Point: 5.6200

>AT265842 WP_268198155.1 NZ_CP113504:513578-513913 [Pectobacterium brasiliense]
MSSIEAPEWGLKCAVTPRFGARLVQEGHYLHYLADRASIVGTFSKTETQSLERCFPELIKLLEQKLRMGELNPRQQNCVT
LHCNEWICEADTLGSVGYVYIVIYPSSAAAE

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References