Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-DnaT |
Location | 375046..375577 | Replicon | chromosome |
Accession | NZ_CP113504 | ||
Organism | Pectobacterium brasiliense strain 21PCA_AGRO2 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A086EVU3 |
Locus tag | OWC53_RS01735 | Protein ID | WP_039282785.1 |
Coordinates | 375290..375577 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A1V2R9J2 |
Locus tag | OWC53_RS01730 | Protein ID | WP_039282788.1 |
Coordinates | 375046..375300 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWC53_RS01710 (OWC53_01710) | 370913..371800 | + | 888 | WP_014913881.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
OWC53_RS01720 (OWC53_01720) | 372251..373444 | - | 1194 | WP_039282790.1 | IS4 family transposase | - |
OWC53_RS01725 (OWC53_01725) | 373613..374818 | + | 1206 | WP_075277970.1 | ISL3 family transposase | - |
OWC53_RS01730 (OWC53_01730) | 375046..375300 | + | 255 | WP_039282788.1 | plasmid stabilization protein | Antitoxin |
OWC53_RS01735 (OWC53_01735) | 375290..375577 | + | 288 | WP_039282785.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OWC53_RS01740 (OWC53_01740) | 375754..376539 | + | 786 | WP_039499670.1 | 4,5-DOPA dioxygenase extradiol | - |
OWC53_RS01745 (OWC53_01745) | 376725..377885 | - | 1161 | WP_010297418.1 | glutathionylspermidine synthase family protein | - |
OWC53_RS01750 (OWC53_01750) | 377897..378571 | - | 675 | WP_010280216.1 | DUF1190 family protein | - |
OWC53_RS01755 (OWC53_01755) | 378990..380381 | - | 1392 | WP_205557405.1 | outer membrane channel protein TolC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 372251..373444 | 1193 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11011.96 Da Isoelectric Point: 10.7694
>T265840 WP_039282785.1 NZ_CP113504:375290-375577 [Pectobacterium brasiliense]
MTYKLKFVPSAMKEWKKLGHPVREQFKKKLVERLENPRVPSAQLHGRKDQYKIKLKSAGYRLVYLVQDETITVMVMGVGK
REGSQIYSDTKGRSA
MTYKLKFVPSAMKEWKKLGHPVREQFKKKLVERLENPRVPSAQLHGRKDQYKIKLKSAGYRLVYLVQDETITVMVMGVGK
REGSQIYSDTKGRSA
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086EVU3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V2R9J2 |